General Information

    • DRAMP ID

    • DRAMP03621

    • Peptide Name

    • Beta-defensin 125 (Beta-defensin 25, DEFB-25; Defensin, beta 125; Human, mammals, animals)

    • Source

    • Homo sapiens (Human)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB125

    • Sequence

    • SFEPQKCWKNNVGHCRRRCLDTERYILLCRNKLSCCISIISHEYTRR

    • Sequence Length

    • 47

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03621 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03621.

Physicochemical Information

    • Formula

    • C244H396N80O68S6

    • Absent Amino Acids

    • AM

    • Common Amino Acids

    • R

    • Mass

    • 5730.68

    • PI

    • 9.33

    • Basic Residues

    • 12

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +8

    • Boman Index

    • -146.71

    • Hydrophobicity

    • -0.692

    • Aliphatic Index

    • 72.55

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8855

    • Absorbance 280nm

    • 192.5

    • Polar Residues

    • 18

DRAMP03621

DRAMP03621 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity (Potential).

    • PTM

    • Contains three disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Discovery of five conserved beta-defensin gene clusters using a computational search strategy.

    • Reference

    • Proc Natl Acad Sci U S A. 2002 Feb 19;99(4):2129-2133.

    • Author

    • Schutte BC, Mitros JP, Bartlett JA, Walters JD, Jia HP, Welsh MJ, Casavant TL, McCray PB Jr.
  • ·Literature 2

    • Title

    • The DNA sequence and comparative analysis of human chromosome 20.

    • Reference

    • Nature. 2001 Dec 20-27;414(6866):865-871.

    • Author

    • Deloukas P, Matthews LH, Ashurst J, Burton J, et al, Rogers J.
  • ·Literature 3

    • Title

    • The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.

    • Reference

    • Genome Res. 2003 Oct;13(10):2265-2270.

    • Author

    • Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, et al, Gray A.