General Information

    • DRAMP ID

    • DRAMP03626

    • Peptide Name

    • Beta-defensin 131 (Beta-defensin 31, DEFB-31; Defensin, beta 131; Human, mammals, animals)

    • Source

    • Homo sapiens (Human)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB131

    • Sequence

    • FISNDECPSEYYHCRLKCNADEHAIRYCADFSICCKLKIIEIDGQKKW

    • Sequence Length

    • 48

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03626 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03626.

Physicochemical Information

    • Formula

    • C250H381N67O74S6

    • Absent Amino Acids

    • MTV

    • Common Amino Acids

    • CI

    • Mass

    • 5701.54

    • PI

    • 6.06

    • Basic Residues

    • 9

    • Acidic Residues

    • 8

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +1

    • Boman Index

    • -96.77

    • Hydrophobicity

    • -0.458

    • Aliphatic Index

    • 71.25

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 10345

    • Absorbance 280nm

    • 220.11

    • Polar Residues

    • 15

DRAMP03626

DRAMP03626 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity (Potential).

    • Tissue specificity

    • Highly expressed in testis. Is moderately expressed in the prostate and small intestine.

    • PTM

    • Contains three disulfide bonds 7-34; 14-28; 18-35 (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • ORFeome-based search of airway epithelial cell-specific novel human [beta]-defensin genes.

    • Reference

    • Am J Respir Cell Mol Biol. 2003 Jul;29(1):71-80.

    • Author

    • Kao CY, Chen Y, Zhao YH, Wu R.
  • ·Literature 2

    • Title

    • Generation and annotation of the DNA sequences of human chromosomes 2 and 4.

    • Reference

    • Nature. 2005 Apr 7;434(7034):724-731.

    • Author

    • Kremitzki C, Oddy L, Du H, et al, Wilson R.K.