General Information

    • DRAMP ID

    • DRAMP18315

    • Peptide Name

    • Aureocin A70 (AurB)(Bacteriocin)

    • Source

    • Staphylococcus aureus A70

    • Family

    • Belongs to the class II bacteriocin

    • Gene

    • aurB

    • Sequence

    • MGAVAKFLGKAALGGAAGGATYAGLKKIFG

    • Sequence Length

    • 30

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

    • Gram-positive

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18315 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18315.

Physicochemical Information

    • Formula

    • C129H210N34O33S

    • Absent Amino Acids

    • CDEHNPQRSW

    • Common Amino Acids

    • AG

    • Mass

    • 2797.35

    • PI

    • 10.18

    • Basic Residues

    • 4

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +4

    • Boman Index

    • 2912

    • Hydrophobicity

    • 0.707

    • Aliphatic Index

    • 88.33

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1490

    • Absorbance 280nm

    • 51.38

    • Polar Residues

    • 10

DRAMP18315

DRAMP18315 chydropathy plot

Comments Information

    • Aureocin A70 is a multipeptide bacteriocin composed of four related peptides that are small (30-31 amino acid residues), strongly cationic (pI of 9.85 to 10.04) and highly hydrophobic. These peptides also have a high content of small amino acid residues like glycine (23

Literature Information

  • ·Literature 1

    • Title

    • Molecular characterisation of aureocin A70, a multi-peptide bacteriocin isolated from Staphylococcus aureus.

    • Reference

    • J Mol Biol. 2001 Aug 31;311(5):939-49.

    • Author

    • Netz DJ, Sahl HG, Marcelino R, dos Santos Nascimento J, de Oliveira SS, Soares MB, do Carmo de Freire Bastos M.