General Information

    • DRAMP ID

    • DRAMP18321

    • Peptide Name

    • Epidermicin NI01(Bacteriocin)

    • Source

    • Staphylococcus epidermidisstrain 224

    • Family

    • Belongs to the class IId bacteriocin

    • Gene

    • Not found

    • Sequence

    • MAAFMKLIQFLATKGQKYVSLAWKRKGTILKWINAGQSFEWIYKQIKKLWA

    • Sequence Length

    • 51

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

    • Gram-positive

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Epidermicin NI01 contains 51 residues with four tryptophan and nine lysine residues, and the sequence showed approximately 50% identity to peptides lacticin Z, lacticin Q, and aureocin A53.

    • Helical Wheel Diagram

    • DRAMP18321 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18321.

Physicochemical Information

    • Formula

    • C291H452N72O65S2

    • Absent Amino Acids

    • CDHP

    • Common Amino Acids

    • K

    • Mass

    • 6063.35

    • PI

    • 10.42

    • Basic Residues

    • 10

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 24

    • Net Charge

    • +9

    • Boman Index

    • -2282

    • Hydrophobicity

    • -0.045

    • Aliphatic Index

    • 93.92

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 24980

    • Absorbance 280nm

    • 499.6

    • Polar Residues

    • 10

DRAMP18321

DRAMP18321 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Identification, characterization, and recombinant expression of epidermicin NI01, a novel unmodified bacteriocin produced by Staphylococcus epidermidis that displays potent activity against Staphylococci.

    • Reference

    • Antimicrob Agents Chemother. 2012 Mar;56(3):1539-47.

    • Author

    • Sandiford S, Upton M.