General Information

    • DRAMP ID

    • DRAMP18355

    • Peptide Name

    • Lacticin Z (bacteriocin)

    • Source

    • Lactococcus lactis QU 14

    • Family

    • Belongs to the lantibiotic family.

    • Gene

    • Not found

    • Sequence

    • MAAFMKLIQFLATKGQKYVSLAWKHKGTILKWINAGQSFEWIYKQIKKLWA

    • Sequence Length

    • 51

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • Active against S. saprophyticus (MIC 82.3-160 nM), S. hominis, S. warneri, E. faecalis (MIC 160 nM), including multidrug-resistant S. epidermidis strains causing biofilm-related infections (MIC 10-658 nM), S. aureus 1195 (MRSA), and vancomycin-resistant enterococci (VRE) (MIC 160-329 nM). THe recombinant peptide shows activity against M. luteus and S. aureus strains in lawn assays.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18355 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP18355.

Physicochemical Information

    • Formula

    • C291H445N71O64S2

    • Absent Amino Acids

    • CDPR

    • Common Amino Acids

    • K

    • Mass

    • 6044.31

    • PI

    • 10.24

    • Basic Residues

    • 10

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 24

    • Net Charge

    • +9

    • Boman Index

    • -1256

    • Hydrophobicity

    • -0.019

    • Aliphatic Index

    • 92.12

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 24980

    • Absorbance 280nm

    • 489.8

    • Polar Residues

    • 10

DRAMP18355

DRAMP18355 chydropathy plot

Comments Information

    • PTM

    • N-terminal Met is formylated.

Literature Information

  • ·Literature 1

    • Title

    • Characterization and structure analysis of a novel bacteriocin, lacticin Z, produced by Lactococcus lactis QU 14.

    • Reference

    • Biosci Biotechnol Biochem. 2007 Aug;71(8):1984-92.

    • Author

    • Iwatani S, Zendo T, Yoneyama F, Nakayama J, Sonomoto K.