General Information

    • DRAMP ID

    • DRAMP18375

    • Peptide Name

    • hBD-5 (human beta-defensin 5)

    • Source

    • Homo sapiens

    • Family

    • Belongs to the beta-defensin family.

    • Gene

    • Not found

    • Sequence

    • GLDFSQPFPSGEFAVCESCKLGRGKCRKECLENEKPDGNCRLNFLCCRQRI

    • Sequence Length

    • 51

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • Active against E. coli K12.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18375 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18375.

Physicochemical Information

    • Formula

    • C244H389N75O73S7

    • Absent Amino Acids

    • HMTWY

    • Common Amino Acids

    • C

    • Mass

    • 5783.67

    • PI

    • 8.26

    • Basic Residues

    • 9

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +2

    • Boman Index

    • -12854

    • Hydrophobicity

    • -0.598

    • Aliphatic Index

    • 52.5

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 375

    • Absorbance 280nm

    • 7.35

    • Polar Residues

    • 18

DRAMP18375

DRAMP18375 chydropathy plot

Comments Information

    • PTM

    • There are 7 cysteines, making it likely to form an intermolecular S-S bond.

Literature Information

  • ·Literature 1

    • Title

    • Identification of multiple novel epididymis-specific beta-defensin isoforms in humans and mice.

    • Reference

    • J Immunol. 2002 Sep 1;169(5):2516-23.

    • Author

    • Yamaguchi Y, Nagase T, Makita R, Fukuhara S, Tomita T, Tominaga T, Kurihara H, Ouchi Y.