• DRAMP ID

    • DRAMP00089
    • Peptide Name

    • Bacteriocin E50-52 (Preclinical)
    • Source

    • Enterococcus faecium (Streptococcus faecium) (Gram-positive bacteria)
    • Family

    • Belongs to the class IIa bacteriocin
    • Gene

    • Not found
    • Sequence

    • TTKNYGNGVCNSVNWCQCGNVWASCNLATGCAAWLCKLA
    • Sequence Length

    • 39
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • Gram-negative bacteria: Campylobacter jejuni (MIC=0.025-6.4 µg/ml), Yersinia enterocolitica, Yersinia pseudotuberculosis, Escherichia coli O157:H7 (MIC<1.6 µg/ml);
      • Gram-positive bacteria:
        Target OrganismActivity
        Staphylococcus aureusMIC=0.2-0.8 µg/ml
        Staphylococcus epidermidisMIC=0.2-0.8 µg/ml
        Listeria monocytogenesMIC=2-8 µg/ml
        Listeria grayi-
        Listeria innocua-
        Listeria ivanovii-
        Listeria denitrificansMIC=32 µg/ml
        Morganella morganii-
        Salmonella spp.-
        Shigella dysenteriae-
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • None
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00089 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00089.
    • Formula

    • C175H267N51O53S6
    • Absent Amino Acids

    • DEFHIMPR
    • Common Amino Acids

    • CN
    • Mass

    • 4125.71
    • PI

    • 8.29
    • Basic Residues

    • 2
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 14
    • Net Charge

    • +2
    • Boman Index

    • -16.77
    • Hydrophobicity

    • 0.164
    • Aliphatic Index

    • 65.13
    • Half Life

      • Mammalian:7.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 18365
    • Absorbance 280nm

    • 483.29
    • Polar Residues

    • 22

DRAMP00089

DRAMP00089 chydropathy plot
    • Function

    • Bacteriocin active against the Gram-negative bacteria and the Gram-positive bacteria. When added to the drinking water of chickens, causes a decrease in the levels of Campylobacter jejuni and S. enteritidis in the ceca, and in the levels of S.enteritidis in the liver and spleen.
  • ·Literature 1
    • Title

    • Diverse antimicrobial killing by Enterococcus faecium E 50-52 bacteriocin.
    • Reference

    • J Agric Food Chem. 2008 Mar 26;56(6):1942-1948.
    • Author

    • Svetoch EA, Eruslanov BV, Perelygin VV, Mitsevich EV, Mitsevich IP, Borzenkov VN, Levchuk VP, Svetoch OE, Kovalev YN, Stepanshin YG, Siragusa GR, Seal BS, Stern NJ.