• • DRAMP ID

  • DRAMP00089

• • Peptide Name

  • Bacteriocin E50-52 (Preclinical)

• • Source

  • Enterococcus faecium (Streptococcus faecium) (Gram-positive bacteria)

• • Family

  • Belongs to the class IIa bacteriocin

• • Gene

  • Not found

• • Sequence

  • TTKNYGNGVCNSVNWCQCGNVWASCNLATGCAAWLCKLA

• • Sequence Length

  • 39

• • UniProt Entry

  • P85148

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

• • Target Organism

  • • Gram-negative bacteria: Campylobacter jejuni (MIC=0.025-6.4 µg/ml), Yersinia enterocolitica, Yersinia pseudotuberculosis, Escherichia coli O157:H7 (MIC<1.6 µg/ml);
    • Gram-positive bacteria: Staphylococcus aureus (MIC=0.2-0.8 µg/ml), Staphylococcus epidermidis (MIC=0.2-0.8 µg/ml), Listeria monocytogenes (MIC=2-8 µg/ml), Listeria grayi, Listeria innocua, Listeria ivanovii, Listeria denitrificans (MIC=32 µg/ml), Morganella morganii, Salmonella spp., Shigella dysenteriae.

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • No cytotoxicity information found in the reference(s) presented

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Linear

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Free

• • Nonterminal Modifications and Unusual Amino Acids

  • None

• • Stereochemistry

  • L

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP00089.

DRAMP00089

• • Function

  • Bacteriocin active against the Gram-negative bacteria and the Gram-positive bacteria. When added to the drinking water of chickens, causes a decrease in the levels of Campylobacter jejuni and S. enteritidis in the ceca, and in the levels of S.enteritidis in the liver and spleen.

• ·Literature 1

• • Title

  • Diverse antimicrobial killing by Enterococcus faecium E 50-52 bacteriocin.

• • Pubmed ID

  • 18293921

• • Reference

  • J Agric Food Chem. 2008 Mar 26;56(6):1942-1948.

• • Author

  • Svetoch EA, Eruslanov BV, Perelygin VV, Mitsevich EV, Mitsevich IP, Borzenkov VN, Levchuk VP, Svetoch OE, Kovalev YN, Stepanshin YG, Siragusa GR, Seal BS, Stern NJ.