• • DRAMP ID

  • DRAMP00107

• • Peptide Name

  • Bacteriocin L-1077

• • Source

  • Lactobacillus salivarius L-1077 (NRRL B-50053) (Gram-positive bacteria)

• • Family

  • Belongs to the class IIa bacteriocin

• • Gene

  • Not found

• • Sequence

  • TNYGNGVGVPDAIMAGIIKLIFIFNIRQGYNFGKKAT

• • Sequence Length

  • 37

• • UniProt Entry

  • No entry found

• • Protein Existence

  • Not found

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

• • Target Organism

  • • Gram-negative bacteria: Salmonella Enteritidis 1 (MIC=0.19 ug/ml), S. Enteritidis 4 (MIC=0.38 ug/ml), S. Enteritidis 204 (MIC=0.38 ug/ml), S. Enteritidis 237 (MIC=0.19 ug/ml), Salmonella Choleraesuis 434/4 (MIC=0.38 ug/ml), S. Choleraesuis 370 (MIC=0.19 ug/ml), Salmonella Typhimurium 483/6 (MIC=0.19 ug/ml), S. Typhimurium 44/8 (MIC=0.19 ug/ml), Salmonella Gallinarum-Pullorum (MIC=0.19 ug/ml), Escherichia coli HB 101 (MIC=0.19 ug/ml), E. coli-600 (MIC=0.19 ug/ml), E. coli O157:H7 Y-63 (MIC=0.19 ug/ml), E. coli O157:H7 G-35 (MIC=0.19 ug/ml), E. coli O157:H7 OD 30 (MIC=0.19 ug/ml), E. coli O157:H7 T lab 39 (MIC=0.19 ug/ml), Yersinia enterocolitica 03 (MIC=0.76 ug/ml), Y. enterocolitica 09 (MIC=0.76 ug/ml), Y. enterocolitica 11 (MIC=0.76 ug/ml), Citrobacter freundii (MIC=0.76 ug/ml), Klebsiella pneumoniae (MIC=0.76 ug/ml), Shigella dysenteriae (MIC=0.76 ug/ml), Yersinia pseudotuberculosis 4 (MIC=0.76 ug/ml), Y. pseudotuberculosis 99/14 (MIC=0.76 µg/ml), Pseudomonas aeruginosa 508 (MIC=0.38 ug/ml), Proteus mirabilis (MIC=0.38 ug/ml), Morganella morganii (MIC=0.38 µg/ml), Proteus vulgaris 7A (MIC=1.5 ug/ml),Campylobacter jejuni L-4 (MIC=0.09 ug/ml);
    • Gram-positive bacteria: Clostridium perfringens 13124 (MIC=0.7 ug/ml), Listeria monocytogenes A 9-72 (MIC=0.19 ug/ml), Staphylococcus aureus (MIC=0.76 ug/ml), Staphylococcus epidermidis (MIC=0.76 ug/ml).

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • No cytotoxicity information found in the reference(s) presented

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Linear

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Free

• • Nonterminal Modifications and Unusual Amino Acids

  • None

• • Stereochemistry

  • L

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP00107.

DRAMP00107

• • Comment

  • No comments found on DRAMP database

• ·Literature 1

• • Title

  • Isolation of Lactobacillus salivarius 1077 (NRRL B-50053) and characterization of its bacteriocin, including the antimicrobial activity spectrum.

• • Pubmed ID

  • 21378051

• • Reference

  • Appl Environ Microbiol. 2011 Apr;77(8):2749-2754.

• • Author

  • Svetoch EA, Eruslanov BV, Levchuk VP, Perelygin VV, Mitsevich EV, Mitsevich IP, Stepanshin J, Dyatlov I, Seal BS, Stern NJ.