• • DRAMP ID

  • DRAMP00107

• • Peptide Name

  • Bacteriocin L-1077

• • Source

  • Lactobacillus salivarius L-1077 (NRRL B-50053) (Gram-positive bacteria)

• • Family

  • Belongs to the class IIa bacteriocin

• • Gene

  • Not found

• • Sequence

  • TNYGNGVGVPDAIMAGIIKLIFIFNIRQGYNFGKKAT

• • Sequence Length

  • 37

• • UniProt Entry

  • No entry found

• • Protein Existence

  • Not found

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

• • Target Organism

  • • Gram-negative bacteria:

      Target Organism	Activity
      Salmonella Enteritidis 1	MIC=0.19 ug/ml
      S. Enteritidis 4	MIC=0.38 ug/ml
      S. Enteritidis 204	MIC=0.38 ug/ml
      S. Enteritidis 237	MIC=0.19 ug/ml
      Salmonella Choleraesuis 434/4	MIC=0.38 ug/ml
      S. Choleraesuis 370	MIC=0.19 ug/ml
      Salmonella Typhimurium 483/6	MIC=0.19 ug/ml
      S. Typhimurium 44/8	MIC=0.19 ug/ml
      Salmonella Gallinarum-Pullorum	MIC=0.19 ug/ml
      Escherichia coli HB 101	MIC=0.19 ug/ml
      E. coli-600	MIC=0.19 ug/ml
      E. coli O157:H7 Y-63	MIC=0.19 ug/ml
      E. coli O157:H7 G-35	MIC=0.19 ug/ml
      E. coli O157:H7 OD 30	MIC=0.19 ug/ml
      E. coli O157:H7 T lab 39	MIC=0.19 ug/ml
      Yersinia enterocolitica 03	MIC=0.76 ug/ml
      Y. enterocolitica 09	MIC=0.76 ug/ml
      Y. enterocolitica 11	MIC=0.76 ug/ml
      Citrobacter freundii	MIC=0.76 ug/ml
      Klebsiella pneumoniae	MIC=0.76 ug/ml
      Shigella dysenteriae	MIC=0.76 ug/ml
      Yersinia pseudotuberculosis 4	MIC=0.76 ug/ml
      Y. pseudotuberculosis 99/14	MIC=0.76 µg/ml
      Pseudomonas aeruginosa 508	MIC=0.38 ug/ml
      Proteus mirabilis	MIC=0.38 ug/ml
      Morganella morganii	MIC=0.38 µg/ml
      Proteus vulgaris 7A	MIC=1.5 ug/ml
      Campylobacter jejuni L-4 (MIC=0.09 ug/ml);	-

    • Gram-positive bacteria:

      Target Organism	Activity
      Clostridium perfringens 13124	MIC=0.7 ug/ml
      Listeria monocytogenes A 9-72	MIC=0.19 ug/ml
      Staphylococcus aureus	MIC=0.76 ug/ml
      Staphylococcus epidermidis	MIC=0.76 ug/ml

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • No cytotoxicity information found in the reference(s) presented

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Linear

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Free

• • Nonterminal Modifications and Unusual Amino Acids

  • None

• • Stereochemistry

  • L

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP00107.

DRAMP00107

• • Comment

  • No comments found on DRAMP database

• ·Literature 1

• • Title

  • Isolation of Lactobacillus salivarius 1077 (NRRL B-50053) and characterization of its bacteriocin, including the antimicrobial activity spectrum.

• • Pubmed ID

  • 21378051

• • Reference

  • Appl Environ Microbiol. 2011 Apr;77(8):2749-2754.

• • Author

  • Svetoch EA, Eruslanov BV, Levchuk VP, Perelygin VV, Mitsevich EV, Mitsevich IP, Stepanshin J, Dyatlov I, Seal BS, Stern NJ.