• DRAMP ID

    • DRAMP00107
    • Peptide Name

    • Bacteriocin L-1077
    • Source

    • Lactobacillus salivarius L-1077 (NRRL B-50053) (Gram-positive bacteria)
    • Family

    • Belongs to the class IIa bacteriocin
    • Gene

    • Not found
    • Sequence

    • TNYGNGVGVPDAIMAGIIKLIFIFNIRQGYNFGKKAT
    • Sequence Length

    • 37
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • SMILES

    • CC[C@@H](C)[C@H](NC(=O)C[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)CNC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)CNC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](N)[C@@H](C)O)C(C)C)C(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCSC)C(=O)NCC(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)O)[C@H](C)CC)[C@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)O)[C@@H](C)O)[C@H](C)CC)[C@H](C)CC)[C@H](C)CC
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • Gram-negative bacteria:
        Target OrganismActivity
        Salmonella Enteritidis 1MIC=0.19 ug/ml
        S. Enteritidis 4MIC=0.38 ug/ml
        S. Enteritidis 204MIC=0.38 ug/ml
        S. Enteritidis 237MIC=0.19 ug/ml
        Salmonella Choleraesuis 434/4MIC=0.38 ug/ml
        S. Choleraesuis 370MIC=0.19 ug/ml
        Salmonella Typhimurium 483/6MIC=0.19 ug/ml
        S. Typhimurium 44/8MIC=0.19 ug/ml
        Salmonella Gallinarum-PullorumMIC=0.19 ug/ml
        Escherichia coli HB 101MIC=0.19 ug/ml
        E. coli-600MIC=0.19 ug/ml
        E. coli O157:H7 Y-63MIC=0.19 ug/ml
        E. coli O157:H7 G-35MIC=0.19 ug/ml
        E. coli O157:H7 OD 30MIC=0.19 ug/ml
        E. coli O157:H7 T lab 39MIC=0.19 ug/ml
        Yersinia enterocolitica 03MIC=0.76 ug/ml
        Y. enterocolitica 09MIC=0.76 ug/ml
        Y. enterocolitica 11MIC=0.76 ug/ml
        Citrobacter freundiiMIC=0.76 ug/ml
        Klebsiella pneumoniaeMIC=0.76 ug/ml
        Shigella dysenteriaeMIC=0.76 ug/ml
        Yersinia pseudotuberculosis 4MIC=0.76 ug/ml
        Y. pseudotuberculosis 99/14MIC=0.76 µg/ml
        Pseudomonas aeruginosa 508MIC=0.38 ug/ml
        Proteus mirabilisMIC=0.38 ug/ml
        Morganella morganiiMIC=0.38 µg/ml
        Proteus vulgaris 7AMIC=1.5 ug/ml
        Campylobacter jejuni L-4MIC=0.09 ug/ml
      • Gram-positive bacteria:
        Target OrganismActivity
        Clostridium perfringens 13124MIC=0.7 ug/ml
        Listeria monocytogenes A 9-72MIC=0.19 ug/ml
        Staphylococcus aureusMIC=0.76 ug/ml
        Staphylococcus epidermidisMIC=0.76 ug/ml
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • None
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C185H290N48O49S
    • Absent Amino Acids

    • CEHSW
    • Common Amino Acids

    • GI
    • Mass

    • 4002.69
    • PI

    • 9.82
    • Basic Residues

    • 4
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 15
    • Net Charge

    • +3
    • Boman Index

    • -12.93
    • Hydrophobicity

    • 0.262
    • Aliphatic Index

    • 97.57
    • Half Life

      • Mammalian:7.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 2980
    • Absorbance 280nm

    • 82.78
    • Polar Residues

    • 14

DRAMP00107

    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Isolation of Lactobacillus salivarius 1077 (NRRL B-50053) and characterization of its bacteriocin, including the antimicrobial activity spectrum.
    • Reference

    • Appl Environ Microbiol. 2011 Apr;77(8):2749-2754.
    • Author

    • Svetoch EA, Eruslanov BV, Levchuk VP, Perelygin VV, Mitsevich EV, Mitsevich IP, Stepanshin J, Dyatlov I, Seal BS, Stern NJ.