• • DRAMP ID

  • DRAMP00136

• • Peptide Name

  • Enterocin E-760 (Bacteriocin)

• • Source

  • Enterococcus sp. (Gram-positive bacteria)

• • Family

  • Belongs to the class IIb bacteriocin

• • Gene

  • Not found

• • Sequence

  • NRWYCNSAAGGVGGAAVCGLAGYVGEAKENIAGEVRKGWGMAGGFTHNKACKSFPGSGWASG

• • Sequence Length

  • 62

• • UniProt Entry

  • P85147

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

• • Target Organism

  • • [Ref.18086839]Gram-positive bacteria: Listeria monocytogenes 9-72 (MIC=0.1 μg/ml), Staphylococcus epidermidis (MIC=1.6 μg/ml), S. aureus (MIC=1.6 μg/ml);
    • Gram-negative bacteria: S. enterica serovar Enteritidis 1 (MIC=0.2 μg/ml), S. enterica serovar Enteritidis 4 (MIC=0.4 μg/ml), S. enterica serovar Enteritidis 204 (MIC=0.2 μg/ml), S. enterica serovar Enteritidis 237 (MIC=0.2 μg/ml), S. enterica serovar Choleraesuis 434/4 (MIC=0.4 μg/ml), S. enterica serovar Choleraesuis 370 (MIC=0.4 μg/ml), S. enterica serovar Typhimurium 383/60 (MIC=0.4 μg/ml), S. enterica serovar Typhimurium 320 (MIC=0.2 μg/ml), S. enterica serovar Gallinarum biovar Pullorum (MIC=0.4 μg/ml), Escherichia coli HB101 (MIC=0.1 μg/ml), E. coli C600 (MIC=0.1 μg/ml), E. coli O157:H7 Y-63 (MIC=1.6 μg/ml), E. coli O157:H7 G-3 (MIC=1.6 μg/ml), E. coli O157:H7 OD-3 (MIC=1.6 μg/ml), E. coli O157:H7 T-39 (MIC=1.6 μg/ml), Yersinia enterocolitica 03 (MIC=0.1 μg/ml), Y. enterocolitica 09 (MIC=0.1 μg/ml), Y. enterocolitica 04 (MIC=0.1 μg/ml), Y. pseudotuberculosis ser 4 (MIC=3.2 μg/ml), Y. pseudotuberculosis 14 (MIC=3.2 μg/ml), Citrobacter freundii (MIC=1.6 μg/ml), Klebsiella pneumoniae (MIC=3.2 μg/ml), Shigella dysenteriae (MIC=0.1 μg/ml), Campylobacter jejuni L4 (MIC=0.1 μg/ml), Campylobacter P 1-R (MIC=0.2 μg/ml), Campylobacter P-45 (MIC=0.4 μg/ml), Campylobacter lari R (MIC=0.2 μg/ml), Campylobacter LB 6-R (MIC=0.1 μg/ml), Campylobacter C/D (MIC=0.2 μg/ml),.

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • No cytotoxicity information found in the reference(s) presented

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Linear

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Free

• • Nonterminal Modifications and Unusual Amino Acids

  • None

• • Stereochemistry

  • L

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• Please click DRAMP00136_predicted_structure.pdb to download.

DRAMP00136

• • Function

  • The enterocin demonstrated thermostability by retaining activity after 5 min at 100 degrees C and was stable at pH values between 5.0 and 8.7. However, activity was lost below pH 3.0 and above pH 9.5. No hemolytic activity.

• ·Literature 1

• • Title

  • Isolation and purification of enterocin E-760 with broad antimicrobial activity against gram-positive and Gram-negative bacteria.

• • Pubmed ID

  • 18086839

• • Reference

  • Antimicrob Agents Chemother. 2008 Mar;52(3):1094-1100.

• • Author

  • Line JE, Svetoch EA, Eruslanov BV, Perelygin VV, Mitsevich EV, Mitsevich IP, Levchuk VP, Svetoch OE, Seal BS, Siragusa GR, Stern NJ.