• • DRAMP ID

  • DRAMP00136

• • Peptide Name

  • Enterocin E-760 (Bacteriocin)

• • Source

  • Enterococcus sp. (Gram-positive bacteria)

• • Family

  • Belongs to the class IIb bacteriocin

• • Gene

  • Not found

• • Sequence

  • NRWYCNSAAGGVGGAAVCGLAGYVGEAKENIAGEVRKGWGMAGGFTHNKACKSFPGSGWASG

• • Sequence Length

  • 62

• • UniProt Entry

  • P85147

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

• • Target Organism

  • • [Ref.18086839]Gram-positive bacteria:

      Target Organism	Activity
      Listeria monocytogenes 9-72	MIC=0.1 μg/ml
      Staphylococcus epidermidis	MIC=1.6 μg/ml
      S. aureus (MIC=1.6 μg/ml);	-

    • Gram-negative bacteria:

      Target Organism	Activity
      S. enterica serovar Enteritidis 1	MIC=0.2 μg/ml
      S. enterica serovar Enteritidis 4	MIC=0.4 μg/ml
      S. enterica serovar Enteritidis 204	MIC=0.2 μg/ml
      S. enterica serovar Enteritidis 237	MIC=0.2 μg/ml
      S. enterica serovar Choleraesuis 434/4	MIC=0.4 μg/ml
      S. enterica serovar Choleraesuis 370	MIC=0.4 μg/ml
      S. enterica serovar Typhimurium 383/60	MIC=0.4 μg/ml
      S. enterica serovar Typhimurium 320	MIC=0.2 μg/ml
      S. enterica serovar Gallinarum biovar Pullorum	MIC=0.4 μg/ml
      Escherichia coli HB101	MIC=0.1 μg/ml
      E. coli C600	MIC=0.1 μg/ml
      E. coli O157:H7 Y-63	MIC=1.6 μg/ml
      E. coli O157:H7 G-3	MIC=1.6 μg/ml
      E. coli O157:H7 OD-3	MIC=1.6 μg/ml
      E. coli O157:H7 T-39	MIC=1.6 μg/ml
      Yersinia enterocolitica 03	MIC=0.1 μg/ml
      Y. enterocolitica 09	MIC=0.1 μg/ml
      Y. enterocolitica 04	MIC=0.1 μg/ml
      Y. pseudotuberculosis ser 4	MIC=3.2 μg/ml
      Y. pseudotuberculosis 14	MIC=3.2 μg/ml
      Citrobacter freundii	MIC=1.6 μg/ml
      Klebsiella pneumoniae	MIC=3.2 μg/ml
      Shigella dysenteriae	MIC=0.1 μg/ml
      Campylobacter jejuni L4	MIC=0.1 μg/ml
      Campylobacter P 1-R	MIC=0.2 μg/ml
      Campylobacter P-45	MIC=0.4 μg/ml
      Campylobacter lari R	MIC=0.2 μg/ml
      Campylobacter LB 6-R	MIC=0.1 μg/ml
      Campylobacter C/D	MIC=0.2 μg/ml

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • No cytotoxicity information found in the reference(s) presented

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Linear

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Free

• • Nonterminal Modifications and Unusual Amino Acids

  • None

• • Stereochemistry

  • L

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP00136.

DRAMP00136

• • Function

  • The enterocin demonstrated thermostability by retaining activity after 5 min at 100 degrees C and was stable at pH values between 5.0 and 8.7. However, activity was lost below pH 3.0 and above pH 9.5. No hemolytic activity.

• ·Literature 1

• • Title

  • Isolation and purification of enterocin E-760 with broad antimicrobial activity against gram-positive and Gram-negative bacteria.

• • Pubmed ID

  • 18086839

• • Reference

  • Antimicrob Agents Chemother. 2008 Mar;52(3):1094-1100.

• • Author

  • Line JE, Svetoch EA, Eruslanov BV, Perelygin VV, Mitsevich EV, Mitsevich IP, Levchuk VP, Svetoch OE, Seal BS, Siragusa GR, Stern NJ.