• • DRAMP ID

  • DRAMP00171

• • Peptide Name

  • Lactocyclicin Q (Bacteriocin)

• • Source

  • Lactococcus sp. strain QU 12 (Gram-positive bacteria)

• • Family

  • Belongs to the class IIc bacteriocin

• • Gene

  • lycQ

• • Sequence

  • LIDHLGAPRWAVDTILGAIAVGNLASWVLALVPGPGWAVKAGLATAAAIVKHQGKAAAAAW

• • Sequence Length

  • 61

• • UniProt Entry

  • B9ZZY0

• • Protein Existence

  • Predicted

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

• • Target Organism

  • • Gram-positive bacteria:

      Target Organism	Activity
      Lactococcus sp.strain QU 12	MIC=34.3 µM
      Lactococcus lactis subsp.lactis JCM 7638	MIC=0.141 µM
      L. lactis subsp.lactis ATCC 19435	MIC=0.141 µM
      L. lactis subsp.lactis IL1403	MIC=0.141 µM
      L. lactis QU 1	MIC=0.141 µM
      L. lactis subsp.cremoris ATCC 19275	MIC=0.283 µM
      Lactococcus raffinolactis JCM 5706	MIC=0.71 µM
      Lactobacillus sakei subsp.sakei JCM 1157	MIC=0.015 µM
      Lactobacillus casei subsp.casei JCM 1134	MIC=2.27 µM
      Leuconostoc brevis JCM 1059	MIC=1.14 µM
      L. acidophilus JCM 1132	MIC=2.86 µM
      L. coryniformis subsp.coryniformis JCM 1164	MIC=2.86 µM
      L. kimchii JCM 10707	MIC=0.71 µM
      L. mesenteroides subsp.mesenteroides JCM 6124	MIC=1.03 µM
      Weissella cibaria JCM 12495	MIC=0.71 µM
      Pediococcus pentosaceus JCM 5885	MIC=0.55 µM
      P. pentosaceus JCM 5890	MIC=2.86 µM
      P. acidilactici JCM 8797	MIC=2.86 µM
      P. dextrinicus JCM 5887	MIC=0.141 µM
      Enterococcus faecium JCM5804	MIC=0.71 µM
      E. hirae ATCC 10541	MIC=0.71 µM
      E. durans NBRC 100479	MIC=0.71 µM
      E. faecalis JCM 5803	MIC=0.26 µM
      Streptococcus salivarius JCM 5707	MIC=22.9 µM
      S. bovis JCM 5802	MIC=22.9 µM
      Bacillus coagulans JCM 2257	MIC=0.015 µM
      B. circulans JCM 2504	MIC=0.031 µM
      B. subtilis JCM 1465	MIC=0.064 µM
      B. cereus JCM 2152	MIC=11.4 µM
      Micrococcus luteus IFO 12708	MIC=5.7 µM
      Listeria innocua ATCC 33090	MIC=1.03 µM
      L. monocytogenes ATCC BAA-679	MIC=1.03 µM
      Staphylococcus aureus subsp.aureus ATCC 12600 (MIC=91.6 µM); Gram-negative bacteria: Escherichia coli JM109 (MIC=34.3 µM)	-
      E. coli NBRC 3301	MIC=17.3 µM

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • No cytotoxicity information found in the reference(s) presented

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Cyclic

• • N-terminal Modification

  • Cyclization (N termini to C termini)

• • C-terminal Modification

  • Cyclization (C termini to N termini)

• • Nonterminal Modifications and Unusual Amino Acids

  • The whole peptide has a cyclic structure in which N and C termini are bound to each other.

• • Stereochemistry

  • L

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP00171.

DRAMP00171

• • Comment

  • No comments found on DRAMP database

• ·Literature 1

• • Title

  • Identification and characterization of lactocyclicin Q, a novel cyclic bacteriocin produced by Lactococcus sp. strain QU 12.

• • Pubmed ID

  • 19139222

• • Reference

  • Appl Environ Microbiol. 2009 Mar;75(6):1552-1558.

• • Author

  • Sawa N, Zendo T, Kiyofuji J, Fujita K, Himeno K, Nakayama J, Sonomoto K.

• ·Literature 2

• • Title

  • Identification and characterization of leucocyclicin Q, a novel cyclic bacteriocin produced by Leuconostoc mesenteroides TK41401.

• • Pubmed ID

  • 21948835

• • Reference

  • Appl Environ Microbiol. 2011 Nov;77(22):8164-8170.

• • Author

  • Masuda Y, Ono H, Kitagawa H, Ito H, Mu F, Sawa N, Zendo T, Sonomoto K.