General Information

    • DRAMP ID

    • DRAMP00173

    • Peptide Name

    • Leucocyclicin Q (Bacteriocin)

    • Source

    • Leuconostoc mesenteroides TK41401 (Gram-positive bacteria)

    • Family

    • Belongs to the class IIc bacteriocin

    • Gene

    • lcyQ

    • Sequence

    • LVNQLGISKSLANTILGAIAVGNLASWVLALVPGPGWATKAALATAETIVKHEGKAAAIAW

    • Sequence Length

    • 61

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria:
        Target OrganismActivity
        Lactococcus lactis ssp. lactis JCM 7638MIC=0.038 µM
        L. lactis ssp. lactis ATCC 19435MIC=0.038 µM
        L. sp. QU 12MIC=1.203 µM
        Lactobacillus sakei ssp. sakei JCM 1157MIC=0.038 µM
        Weissella cibaria JCM 12495MIC=2.405 µM
        W. paramesenteroides JCM 9890MIC=0.075 µM
        Pediococcus pentosaceus JCM 5885MIC=2.405 µM
        P. dextrinicus JCM 5887MIC=0.038 µM
        Enterococcus faecium JCM 5804MIC=0.038 µM
        E. faecalis JCM 5803MIC=0.15 µM
        Streptococcus salivarius JCM 5707MIC=2.405 µM
        S. bovis JCM 5802MIC=0.601 µM
        S. mutans JCM 5705MIC=19.25 µM
        Bacillus coagulans JCM 2257MIC=0.075 µM
        B. subtilis ssp. subtilis JCM 1465MIC=0.601 µM
        B. cereus JCM 2152MIC=2.405 µM
        Kocuria rhizophila NBRC 12708MIC=9.623 µM
        Listeria innocua ATCC 33090MIC=0.601 µM
        Leuconostoc mesenteroides ssp. mes. JCM 6124MIC=0.3 µM
        Escherichia coli JM109MIC=38.49 µM
        E. coli NBRC 3301MIC=38.49 µM

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Cyclization (N termini to C termini)

    • C-terminal Modification

    • Cyclization (C termini to N termini)

    • Nonterminal Modifications and Unusual Amino Acids

    • The whole peptide has a cyclic structure in which N and C termini are bound to each other.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00173 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00173.

Physicochemical Information

    • Formula

    • C282H460N74O77

    • Absent Amino Acids

    • CDFMRY

    • Common Amino Acids

    • A

    • Mass

    • 6119.2

    • PI

    • 9.53

    • Basic Residues

    • 5

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 35

    • Net Charge

    • +3

    • Boman Index

    • 35.71

    • Hydrophobicity

    • 0.751

    • Aliphatic Index

    • 129.84

    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 16500

    • Absorbance 280nm

    • 275

    • Polar Residues

    • 16

DRAMP00173

DRAMP00173 chydropathy plot

Comments Information

    • Function

    • This precursor showed high similarity to the precursor of lactocyclicin Q, a cyclic bacteriocin produced by Lactococcus sp. strain QU 12. This is the first report of a cyclic bacteriocin produced by a strain of the genus Leuconostoc.

Literature Information

  • ·Literature 1

    • Title

    • Identification and characterization of leucocyclicin Q, a novel cyclic bacteriocin produced by Leuconostoc mesenteroides TK41401.

    • Reference

    • Appl Environ Microbiol. 2011 Nov;77(22):8164-8170.

    • Author

    • Masuda Y, Ono H, Kitagawa H, Ito H, Mu F, Sawa N, Zendo T, Sonomoto K.