General Information

    • DRAMP ID

    • DRAMP00177

    • Peptide Name

    • Enterocin B (EntB; Bacteriocin)

    • Source

    • Enterococcus faecium T136 (Gram-positive bacteria)

    • Family

    • Belongs to the class IId bacteriocin

    • Gene

    • entB

    • Sequence

    • ENDHRMPNNLNRPNNLSKGGAKCGAAIAGGLFGIPKGPLAWAAGLANVYSKCN

    • Sequence Length

    • 53

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Enterococcus faecalis JCM 5803 (MIC=86.9 nM), Enterococcus faecalis OU510 (MIC=174 nM), E. faecium TUA 1344L (MIC=43.4 nM), E. hirae ATCC 10541 (MIC=5.44 nM), Lactobacillus plantarum ATCC 14917 (MIC=86.9 nM), L. sakei ssp. sakei JCM 1157 (MIC=5.44 nM), Bacillus coagulans JCM 2257 (MIC=89000 nM), Bacillus subtilis JCM 1465 (MIC=44500 nM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • The peptide has forms a disulfide bond between Cys-23 and Cys-52

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00177 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00177.

Physicochemical Information

    • Formula

    • C236H376N74O69S3

    • Absent Amino Acids

    • QT

    • Common Amino Acids

    • AGN

    • Mass

    • 5450.22

    • PI

    • 9.59

    • Basic Residues

    • 7

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 18

    • Net Charge

    • +5

    • Boman Index

    • -61.59

    • Hydrophobicity

    • -0.376

    • Aliphatic Index

    • 72.08

    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7115

    • Absorbance 280nm

    • 136.83

    • Polar Residues

    • 21

DRAMP00177

DRAMP00177 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Atypical genetic locus associated with constitutive production of enterocin B by Enterococcus faecium BFE 900.

    • Reference

    • Appl Environ Microbiol. 1999 May;65(5):2170-2178.

    • Author

    • Franz CM, Worobo RW, Quadri LE, Schillinger U, Holzapfel WH, Vederas JC, Stiles ME.
  • ·Literature 2

    • Title

    • Enterocin B, a new bacteriocin from Enterococcus faecium T136 which can act synergistically with enterocin A.

    • Reference

    • Microbiology. 1997 Jul;143 (Pt 7):2287-2294.

    • Author

    • Casaus P, Nilsen T, Cintas LM, Nes IF, Hern¡ndez PE, Holo H.