• DRAMP ID

    • DRAMP00190
    • Peptide Name

    • Leucocin N (Bacteriocin)
    • Source

    • Leuconostoc pseudomesenteroides QU 15 (Gram-positive bacteria)
    • Family

    • Belongs to the class IId bacteriocin
    • Gene

    • LccN
    • Sequence

    • MNKEYNSISNFKKITNKDLQNINGGFIGRAIGDFVYFGAKGLRESGKLLNYYYKHKH
    • Sequence Length

    • 57
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+
    • Target Organism

      • Gram-positive bacteria:
        Target OrganismActivity
        Bacillus circulans JCM 2504TMIC=5.20 µmol/L
        Listeria innocua ATCC 33090MIC=1.30 µmol/L
        Listeria monocytogenes ATCC BAA-679MIC=1.30 µmol/L
        Enterococcus faecalis JCM 5803MIC=5.20 µmol/L
        Lactobacillus plantarum ATCC 14917MIC=2.60 µmol/L
        Lactobacillus sakei ssp. sakei JCM 1157MIC=1.30 µmol/L
        Leuconostoc mesenteroides ssp. mesenteroides JCM 6124MIC=2.60 µmol/L
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • None
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00190 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00190.
    • Formula

    • C301H461N83O83S
    • Absent Amino Acids

    • CPW
    • Common Amino Acids

    • KGN
    • Mass

    • 6602.54
    • PI

    • 9.79
    • Basic Residues

    • 12
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 16
    • Net Charge

    • +8
    • Boman Index

    • -107.32
    • Hydrophobicity

    • -0.744
    • Aliphatic Index

    • 70.18
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 7450
    • Absorbance 280nm

    • 133.04
    • Polar Residues

    • 23

DRAMP00190

DRAMP00190 chydropathy plot
    • Function

    • Leuc.pseudomesenteroides QU 15 (isolated from Nukadoko) produce at least three bacteriocins, leucocin A, and two novel bacteriocins termed leucocin Q and leucocin N.
  • ·Literature 1
    • Title

    • Identification and characterization of novel multiple bacteriocins produced by Leuconostoc pseudomesenteroides QU 15.
    • Reference

    • J Appl Microbiol. 2010 Jul;109(1):282-291.
    • Author

    • Sawa N, Okamura K, Zendo T, Himeno K, Nakayama J, Sonomoto K.