• DRAMP ID

    • DRAMP00222
    • Peptide Name

    • Microcin E492 (MccE492; Bacteriocin)
    • Source

    • Klebsiella pneumoniae RYC492 (Gram-negative bacteria)
    • Family

    • Not found
    • Gene

    • mceA
    • Sequence

    • GETDPNTQLLNDLGNNMAWGAALGAPGGLGSAALGAAGGALQTVGQGLIDHGPVNVFIPVLIGPSWNGSGSGYNSATSSSGSGS
    • Sequence Length

    • 84
    • Protein Existence

    • Protein level
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-
    • Target Organism

      • Gram-negative bacteria:
        Target OrganismActivity
        Escherichia coli FMIC=0.14 µM
        Escherichia coli 363MIC=0.02 µM
        Escherichia coli ML35pMIC=0.14 µM
        Escherichia coli GM1MIC=0.04 µM
        Escherichia coli GM1 KP1060MIC=0.65 µM
        Escherichia coli W3110MIC=0.02 µM
        Escherichia coli W3110-KP1344 Pms7MIC=0.08 µM
        Escherichia coli W3110-6MIC=0.32 µM
        Escherichia coli C600MIC=0.08 µM
        Escherichia coli C600 pHX405MIC=0.16 µM
        Salmonella enteritidisMIC=0.6 µM
        Salmonella typhimuriumMIC=1.2 µM
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Attachment to a siderophore ester
    • Nonterminal Modifications and Unusual Amino Acids

    • [Ref.15102848] The post-translational modification consists of a trimer of N-(2,3-dihydroxybnenzoyl)-L-serine linked via a C-glycosidic linkage to a β-D-glucose moiety, itself linked to the MccE492m Ser-84-carboxyl through an O-glycosidic bond.
    • Stereochemistry

    • L
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C342H532N98O118S
    • Absent Amino Acids

    • CKR
    • Common Amino Acids

    • G
    • Mass

    • 7936.63
    • PI

    • 3.84
    • Basic Residues

    • 1
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 29
    • Net Charge

    • -3
    • Boman Index

    • -24
    • Hydrophobicity

    • 0.066
    • Aliphatic Index

    • 81.43
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 12490
    • Absorbance 280nm

    • 150.48
    • Polar Residues

    • 41

DRAMP00222

DRAMP00222 chydropathy plot
    • Function

    • Channel-forming bacteriocin. Forms cation-selective channels. Active on enterobacteria, with highest activity against Escherichia coli. The unmodified protein is active against Escherichia coli and S. enteritidis. When the siderophore ester is present at Ser-99, antibacterial activity against these species is increased and activity is also detected against E. cloacae and K. pneumoniae.
    • PTM

    • The C-terminal Ser is modified by attachment to a siderophore similar to enterobactin, which can bind one atom of iron. The modification consists of an ester linkage of the serine carboxyl to O6 of a glucose which is linked by a C-glycosidic bond to the 5'-benzoyl of a linear triester of N-(2,3-dihydroxybenzoyl)serine. Presence of the siderophore ester increases the antibacterial activity of the protein.
  • ·Literature 1
    • Title

    • Microcin E492 antibacterial activity: evidence for a TonB-dependent inner membrane permeabilization on Escherichia coli.
    • Reference

    • Mol Microbiol. 2003 Aug;49(4):1031-1041.
    • Author

    • Destoumieux-Garz³n D, Thomas X, Santamaria M, Goulard C, Barth©l©my M, Boscher B, Bessin Y, Molle G, Pons AM, Letellier L, Peduzzi J, Rebuffat S.
  • ·Literature 2
    • Title

    • Siderophore peptide, a new type of post-translationally modified antibacterial peptide with potent activity.
    • Reference

    • J Biol Chem. 2004 Jul 2;279(27):28233-28242.
    • Author

    • Thomas X, Destoumieux-Garz³n D, Peduzzi J, Afonso C, Blond A, Birlirakis N, Goulard C, Dubost L, Thai R, Tabet JC, Rebuffat S.
  • ·Literature 3
    • Title

    • Microcin E492 forms ion channels in phospholipid bilayer membrane.
    • Reference

    • FEBS Lett. 1993 Apr 26;321(2-3):145-148.
    • Author

    • Lagos R, Wilkens M, Vergara C, Cecchi X, Monasterio O.