• • DRAMP ID

  • DRAMP00275

• • Peptide Name

  • Snakin-1 (StSN1; Cys-rich; Plant defensin)

• • Source

  • Solanum tuberosum (potato)

• • Family

  • Not found

• • Gene

  • SN1

• • Sequence

  • GSSFCDSKCKLRCSKAGLADRCLKYCGICCEECKCVPSGTYGNKHECPCYRDKKNSKGKSKCP

• • Sequence Length

  • 63

• • UniProt Entry

  • Q948Z4

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Antifungal

• • Target Organism

  • • [Ref.9885189] Gram-positive bacteria: Listeria monocytogenes (MIC=10 µg/mL), Listeria innocua (MIC=10 µg/mL), Listeria ivanovii (MIC=10 µg/mL), Clavibacter michiganensis (EC50=1 µM), Ralstonia solanacearum (rfa-) (EC50=30 µM), Rhizobium meliloti (EC50=8 µM).
    • Fungi: Botrytis cinerea (EC50=2 µM), Fusarium solani (EC50=3 µM), Fusarium culmorum (EC50=2 µM), Fusarium oxysporum f. sp. conglutinans (EC50=10 µM), Fusarium oxysporum f. sp. lycopersici (EC50=20 µM), Plectosphaerella cucumerina (EC50=10 µM), Colletotrichum graminicola (EC50=10 µM), Colletotrichum lagenarium (EC50=10 µM), Bipolaris maydis (EC50=20 µM), Aspergillus flavus (EC50=20 µM).

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • No cytotoxicity information found in the reference(s) presented

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Cyclic

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Free

• • Nonterminal Modifications and Unusual Amino Acids

  • [Ref.9885189] Six disulfide bonds may be present

• • Stereochemistry

  • L

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP00275.

DRAMP00275

• • Function

  • Has an antimicrobial activity. Causes a rapid aggregation of both Gram-positive and Gram-negative bacteria, but the antimicrobial activity is not correlated with the capacity to aggregate bacteria.

• • Tissue specificity

  • Expressed in tubers, stems, axillary and young floral buds, sepals, petals, stamens and carpels, but not in roots, stolons, shoot apex meristem or young leaves.

• • Induction

  • No responses to methyl jasmonate, ethylene, abscisic acid, salicylic acid, isonicotinic acid, indolacetic acid, gibberellic acid and infection with incompatible bacterial or compatible fungual pathogens.

• • PTM

  • Six disulfide bonds may be present.

• ·Literature 1

• • Title

  • Snakin-2, an antimicrobial peptide from potato whose gene is locally induced by wounding and responds to pathogen infection.

• • Pubmed ID

  • 11891250

• • Reference

  • Plant Physiol. 2002 Mar;128(3):951-961.

• • Author

  • Marta Berrocal-Lobo, Ana Segura, Manuel Moreno, Gemma López, Francisco García-Olmedo, Antonio Molina

• ·Literature 2

• • Title

  • Snakin-1, a peptide from potato that is active against plant pathogens.

• • Pubmed ID

  • 9885189

• • Reference

  • Mol Plant Microbe Interact. 1999 Jan;12(1):16-23.

• • Author

  • A Segura, M Moreno, F Madueño, A Molina, F García-Olmedo