General Information

    • DRAMP ID

    • DRAMP00422

    • Peptide Name

    • Defensin-like protein 1 (Sa-AFP1; Plant defensin)

    • Source

    • Sinapis alba (White mustard) (Brassica hirta)

    • Family

    • Belongs to the DEFL family

    • Gene

    • Not found

    • Sequence

    • QKLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC

    • Sequence Length

    • 51

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • Fungi: Alternaria brassicola (MIC=1.2 µg/ml), Botrytis cinerea (MIC=1.8 µg/ml), Fusarium culmorum (MIC=4 µg/ml), Fusarium oxysporum f.sp.lycopersici (MIC=6 µg/ml), Pyricularia oryzae (MIC=0.5 µg/ml), Verticillium dahliae (MIC=1.5 µg/ml).
      • NOTE: In synthetic low ionic strength fungal growth medium.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Cyclization of a N-terminal glutamine (Conversion to pyrrolidone carboxylic acid)

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • There are four disulfide bonds between Cys4 and Cys51, Cys15 and Cys36, Cys21 and Cys45, Cys25 and Cys47.

    • Stereochemistry

    • L

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00422 helical wheel diagram
  • 1AYJ-> 

    • Predicted Structure

    • There is no predicted structure for DRAMP00422.

Physicochemical Information

    • Formula

    • C242H372N74O70S8

    • Absent Amino Acids

    • DM

    • Common Amino Acids

    • C

    • Mass

    • 5694.55

    • PI

    • 8.72

    • Basic Residues

    • 8

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +6

    • Boman Index

    • -83.47

    • Hydrophobicity

    • -0.451

    • Aliphatic Index

    • 47.84

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8980

    • Absorbance 280nm

    • 179.6

    • Polar Residues

    • 24

DRAMP00422

DRAMP00422 chydropathy plot

Comments Information

    • Function

    • Possesses antifungal activity sensitive to inorganic cations.

Literature Information

  • ·Literature 1

    • Title

    • A new family of basic cysteine-rich plant antifungal proteins from Brassicaceae species.

    • Reference

    • FEBS Lett. 1993 Feb 1;316(3):233-240.

    • Author

    • Terras FR, Torrekens S, Van Leuven F, Osborn RW, Vanderleyden J, Cammue BP, Broekaert WF.
  • ·Literature 2

    • Title

    • Purification and mass spectrometry-based sequencing of yellow mustard (Sinapis alba L.) 6 kDa proteins. Identification as antifungal proteins.

    • Reference

    • Int J Pept Protein Res. 1996 Jun;47(6):437-446.

    • Author

    • Neumann GM, Condron R, Polya GM.