General Information

    • DRAMP ID

    • DRAMP00423

    • Peptide Name

    • Defensin-like protein 2 (Sa-AFP2; Plant defensin)

    • Source

    • Sinapis alba (White mustard) (Brassica hirta)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • QKLCQRPSGTWSGVCGNNNACRNQCINLEKARHGSCNYVFPAHKCICYFPC

    • Sequence Length

    • 50

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • Fungi: Alternaria brassicola (MIC=4.5 µg/ml), Botrytis cinerea (MIC=3.5 µg/ml), Fusarium culmorum (MIC=2.3 µg/ml), Fusarium oxysporum f.sp.lycopersici (MIC=2.3 µg/ml), Pyricularia oryzae (MIC=0.3 µg/ml), Verticillium dahliae (MIC=1.2 µg/ml).
      • NOTE: In synthetic low ionic strength fungal growth medium.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Cyclization of a N-terminal glutamine (Conversion to pyrrolidone carboxylic acid)

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • ①There are four disulfide bonds between Cys4 and Cys51, Cys15 and Cys36, Cys21 and Cys45, Cys25 and Cys47. ②The residue at position 8 is phosphorylated.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00423 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00423.

Physicochemical Information

    • Formula

    • C237H365N73O67S8

    • Absent Amino Acids

    • DM

    • Common Amino Acids

    • C

    • Mass

    • 5565.43

    • PI

    • 8.91

    • Basic Residues

    • 8

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +7

    • Boman Index

    • -76.66

    • Hydrophobicity

    • -0.39

    • Aliphatic Index

    • 48.8

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 8980

    • Absorbance 280nm

    • 183.27

    • Polar Residues

    • 24

DRAMP00423

DRAMP00423 chydropathy plot

Comments Information

    • Function

    • Possesses antifungal activity sensitive to inorganic cations.

Literature Information

  • ·Literature 1

    • Title

    • A new family of basic cysteine-rich plant antifungal proteins from Brassicaceae species.

    • Reference

    • FEBS Lett. 1993 Feb 1;316(3):233-240.

    • Author

    • Terras FR, Torrekens S, Van Leuven F, Osborn RW, Vanderleyden J, Cammue BP, Broekaert WF.