General Information

    • DRAMP ID

    • DRAMP00635

    • Peptide Name

    • Defensin-like protein 195 (Trypsin inhibitor ATTI-1; diDi 4T-1; Plant defensin)

    • Source

    • Arabidopsis thaliana (Mouse-ear cress)

    • Family

    • Belongs to the DEFL family

    • Gene

    • ATTI1

    • Sequence

    • QGNECLKEYGGDVGFGFCAPRIFPTICYTRCRENKGAKGGRCRWGQGSNVKCLCDFCDDTPQ

    • Sequence Length

    • 62

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • The protein contains one alpha-helix and two strands of antiparallel beta-sheet, with a type IV beta-turn connecting the two strands. The alpha-helix and the inhibitory loop are connected to the beta-sheet through three disulfide bridges; a fourth disulfide bridge connects the N- and C-termini. (Ref.3)

    • Helical Wheel Diagram

    • DRAMP00635 helical wheel diagram

    • PDB ID

    • 1JXC resolved by NMR.

    • Predicted Structure

    • There is no predicted structure for DRAMP00635.

Physicochemical Information

    • Formula

    • C291H446N88O89S8

    • Absent Amino Acids

    • HM

    • Common Amino Acids

    • G

    • Mass

    • 6857.76

    • PI

    • 8.19

    • Basic Residues

    • 9

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +2

    • Boman Index

    • -134.77

    • Hydrophobicity

    • -0.629

    • Aliphatic Index

    • 37.74

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8980

    • Absorbance 280nm

    • 147.21

    • Polar Residues

    • 27

DRAMP00635

DRAMP00635 chydropathy plot

Comments Information

    • Function

    • Defense response to fungus.

    • PTM

    • Contains four disulfide bonds.

Literature Information

  • ·Literature 1

    • Title

    • Two large Arabidopsis thaliana gene families are homologous to the Brassica gene superfamily that encodes pollen coat proteins and the male component of the self-incompatibility response.

    • Reference

    • Plant Mol Biol. 2001 May;46(1):17-34.

    • Author

    • Vanoosthuyse V, Miege C, Dumas C, Cock JM.
  • ·Literature 2

    • Title

    • Genome organization of more than 300 defensin-like genes in Arabidopsis.

    • Reference

    • Plant Physiol. 2005 Jun;138(2):600-610.

    • Author

    • Silverstein KA, Graham MA, Paape TD, VandenBosch KA.
  • ·Literature 3

    • Title

    • NMR solution structure of ATTp, an Arabidopsis thaliana trypsin inhibitor.

    • Reference

    • Biochemistry. 2002 Oct 15;41(41):12284-96.

    • Author

    • Zhao Q, Chae YK, Markley JL.