General Information

    • DRAMP ID

    • DRAMP00734

    • Peptide Name

    • Putative defensin-like protein 305 (Plant defensin)

    • Source

    • Arabidopsis thaliana (Mouse-ear cress)

    • Family

    • Belongs to the DEFL family

    • Gene

    • Not found

    • Sequence

    • KTNFDCVNLKCPTPFVTPKCVSGGCECPLKELLTLLSDTNYGVAACIDYCKAKGENAYTCILNHCYCRKPSM

    • Sequence Length

    • 72

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00734 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00734.

Physicochemical Information

    • Formula

    • C342H543N89O103S11

    • Absent Amino Acids

    • QW

    • Common Amino Acids

    • C

    • Mass

    • 7902.27

    • PI

    • 8.08

    • Basic Residues

    • 9

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 19

    • Net Charge

    • +3

    • Boman Index

    • -71.85

    • Hydrophobicity

    • -0.039

    • Aliphatic Index

    • 70.42

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 6585

    • Absorbance 280nm

    • 92.75

    • Polar Residues

    • 32

DRAMP00734

DRAMP00734 chydropathy plot

Comments Information

    • Function

    • May have antifungal activity.

    • PTM

    • Contains three disulfide bonds (By similarity).

    • Caution

    • Lacks 1 of the 4 disulfide bonds, which are conserved features of the family.

Literature Information

  • ·Literature 1

    • Title

    • Two large Arabidopsis thaliana gene families are homologous to the Brassica gene superfamily that encodes pollen coat proteins and the male component of the self-incompatibility response.

    • Reference

    • Plant Mol Biol. 2001 May;46(1):17-34.

    • Author

    • Vanoosthuyse V, Miege C, Dumas C, Cock JM.
  • ·Literature 2

    • Title

    • Genome organization of more than 300 defensin-like genes in Arabidopsis.

    • Reference

    • Plant Physiol. 2005 Jun;138(2):600-610.

    • Author

    • Silverstein KA, Graham MA, Paape TD, VandenBosch KA.