General Information

    • DRAMP ID

    • DRAMP00747

    • Peptide Name

    • Defensin-like protein (Flower-specific gamma-thionin; Plant defensin)

    • Source

    • Nicotiana tabacum (Common tobacco)

    • Family

    • Belongs to the DEFL family

    • Gene

    • FST

    • Sequence

    • RECKTESNTFPGICITKPPCRKACISEKFTDGHCSKLLRRCLCTKPCVFDEKMIKTGAETLVEEAKTLAAALLEEEIMDN

    • Sequence Length

    • 80

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • Fungi: Fusarium oxysporum and Botrytis cinerea.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00747 helical wheel diagram

    • PDB ID

    • 1MR4 resolved by NMR.
  • 1MR4-> 

    • Predicted Structure

    • There is no predicted structure for DRAMP00747.

Physicochemical Information

    • Formula

    • C382H635N105O120S10

    • Absent Amino Acids

    • QWY

    • Common Amino Acids

    • EK

    • Mass

    • 8939.48

    • PI

    • 6.75

    • Basic Residues

    • 14

    • Acidic Residues

    • 13

    • Hydrophobic Residues

    • 23

    • Net Charge

    • +1

    • Boman Index

    • -147.91

    • Hydrophobicity

    • -0.299

    • Aliphatic Index

    • 73.25

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 500

    • Absorbance 280nm

    • 6.33

    • Polar Residues

    • 24

DRAMP00747

DRAMP00747 chydropathy plot

Comments Information

    • Function

    • Involved in floral organogenesis. May play a protective role in flowers by protecting the reproductive organs from potential pathogen attack.

    • Tissue specificity

    • Found in petals, stamen and pistils, but not in sepals. In particular, accumulation in a configuration surrounding the inner reproductive whorls.

    • Developmental stage

    • Accumulates in developing flowers and its level drops as flowers mature.

    • PTM

    • Contains four disulfide bonds 3-47; 14-34; 20-41; 24-43.

Literature Information

  • ·Literature 1

    • Title

    • A flower-specific cDNA encoding a novel thionin in tobacco.

    • Reference

    • Mol Gen Genet. 1992 Jul;234(1):89-96.

    • Author

    • Gu Q, Kawata EE, Morse MJ, Wu HM, Cheung AY.
  • ·Literature 2

    • Title

    • The three-dimensional solution structure of NaD1, a new floral defensin from Nicotiana alata and its application to a homology model of the crop defense protein alfAFP.

    • Reference

    • J Mol Biol. 2003 Jan 3;325(1):175-188.

    • Author

    • Lay FT, Schirra HJ, Scanlon MJ, Anderson MA, Craik DJ.