General Information

    • DRAMP ID

    • DRAMP00748

    • Peptide Name

    • Defensin-like protein(Brazzein; Plants)

    • Source

    • Pentadiplandra brazzeana

    • Family

    • Belongs to the DEFL family

    • Gene

    • Not found

    • Sequence

    • QDKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY

    • Sequence Length

    • 54

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Antifungal

    • Target Organism

      • Gram-positive bacteria: Bacillus subtilis, Staphylococcus aureus.
      • Gram-positive bacterium: Escherichia coli.
      • Yeast: Candida albicans.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • The brazzein fold, which contains one alpha-helix and three strands of antiparallel beta-sheet.

    • Helical Wheel Diagram

    • DRAMP00748 helical wheel diagram

    • PDB ID

    • 1BRZ resolved by NMR. 4HE7 resolved by X-ray.
  • 1BRZ-> 

    • Predicted Structure

    • There is no predicted structure for DRAMP00748.

Physicochemical Information

    • Formula

    • C276H421N77O89S8

    • Absent Amino Acids

    • MTW

    • Common Amino Acids

    • CK

    • Mass

    • 6498.32

    • PI

    • 6.71

    • Basic Residues

    • 10

    • Acidic Residues

    • 9

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +1

    • Boman Index

    • -155.01

    • Hydrophobicity

    • -1.106

    • Aliphatic Index

    • 43.33

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 9440

    • Absorbance 280nm

    • 178.11

    • Polar Residues

    • 21

DRAMP00748

DRAMP00748 chydropathy plot

Comments Information

    • Function

    • Taste-modifying protein; sweet-tasting. It is 2000 sweeter than sucrose on a molar basis. Has a pH-specific antimicrobial activity against bacteria and fungi.

    • PTM

    • Contains four disulfide bonds 4-52; 16-37; 22-47; 26-49.

Literature Information

  • ·Literature 1

    • Title

    • Multidimensional signatures in antimicrobial peptides.

    • Reference

    • Proc Natl Acad Sci U S A. 2004 May 11;101(19):7363-7368.

    • Author

    • Yount NY, Yeaman MR.
  • ·Literature 2

    • Title

    • Solution structure of the thermostable sweet-tasting protein brazzein.

    • Reference

    • Nat Struct Biol. 1998 Jun;5(6):427-431.

    • Author

    • Caldwell JE, Abildgaard F, Dzakula Z, Ming D, Hellekant G, Markley JL.