• • DRAMP ID

  • DRAMP00749

• • Peptide Name

  • Defensin-like protein 1 (Dm-AMP1; Plant defensin)

• • Source

  • Dahlia merckii (Bedding dahlia)

• • Family

  • Belongs to the DEFL family

• • Gene

  • Not found

• • Sequence

  • ELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHMCFCYFNC

• • Sequence Length

  • 50

• • UniProt Entry

  • P0C8Y4

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Antifungal

• • Target Organism

  • • Gram-positive bacterium: Bacillus subtilis (IC50=150 µg/mL).
    • Medium A: Botrytis cinerea (IC50=12 µg/ml), Cladosporium sphaerospermum (IC50=3 µg/ml), Fusarium culmorum (IC50=5 µg/ml), Leptosphaeria maculans (IC50=1.5 µg/ml), Penicillium digitatum (IC50=2 µg/ml), Trichoderma viride (IC50>100 µg/ml), Septoria tritiei (IC50=1 µg/ml), Verticilium albo-atrum (IC50=4 µg/ml). NOTE: Medium B = 1/2 strength potato dextrose broth.
    • Medium B: Botrytis cinerea (IC50>100 µg/ml), Cladosporium sphaerospermum (IC50=12 µg/ml), Fusarium culmorum (IC50=8 µg/ml), Leptosphaeria maculans (IC50=15 µg/ml), Penicillium digitatum (IC50=70 µg/ml), Trichoderma viride (IC50>100 µg/ml), Septoria tritiei (IC50=4 µg/ml), Verticilium albo-atrum (IC50>100 µg/ml).
    • NOTE: Medium B = Medium A supplemented with 1 mM CaCl2 and 50 mM KCI.

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • cell membrabce

• • Linear/Cyclic

  • Not included yet

• • N-terminal Modification

  • Not included yet

• • C-terminal Modification

  • Not included yet

• • Nonterminal Modifications and Unusual Amino Acids

  • Not included yet

• • Stereochemistry

  • Not included yet

• • Structure

  • Bridge

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP00749.

DRAMP00749

• • Function

  • Possesses antimicrobial activity sensitive to inorganic cations. Has no inhibitory effect on insect gut alpha-amylase. Induces potential changes in fungal membranes and increased K+ efflux and Ca2+ uptake. Interacts with sphingolipids and ergosterols found in fungal plasma membranes.

• • Biotechnological use

  • DmAMP1 expression in heterologous plants such as rice or papaya may provide a broad-spectrum disease resistance.

• • PTM

  • Problely contains four disulfide bonds 3-50;14-35;20-44;24-46.

• ·Literature 1

• • Title

  • DmAMP1, an antifungal plant defensin from dahlia (Dahlia merckii), interacts with sphingolipids from Saccharomyces cerevisiae.

• • Pubmed ID

  • 13129623

• • Reference

  • FEMS Microbiol Lett. 2003 Sep 12;226(1):169-173.

• • Author

  • Thevissen K, Fran§ois IE, Takemoto JY, Ferket KK, Meert EM, Cammue BP.

• ·Literature 2

• • Title

  • Isolation and characterisation of plant defensins from seeds of Asteraceae, Fabaceae, Hippocastanaceae and Saxifragaceae.

• • Pubmed ID

  • 7628617

• • Reference

  • FEBS Lett. 1995 Jul 17;368(2):257-262.

• • Author

  • Osborn RW, De Samblanx GW, Thevissen K, Goderis I, Torrekens S, Van Leuven F, Attenborough S, Rees SB, Broekaert WF.

• ·Literature 3

• • Title

  • Fungal membrane responses induced by plant defensins and thionins.

• • Pubmed ID

  • 8663029

• • Reference

  • Plant Physiol. 2002 Apr;128(4):1346-1358.

• • Author

  • Fran§ois IE, De Bolle MF, Dwyer G, Goderis IJ, Woutors PF, Verhaert PD, Proost P, Schaaper WM, Cammue BP, Broekaert WF.

• ·Literature 4

• • Title

  • Ectopic expression of Dahlia merckii defensin DmAMP1 improves papaya resistance to Phytophthora palmivora by reducing pathogen vigor.

• • Pubmed ID

  • 17216480

• • Reference

  • J Biol Chem. 1996 Jun 21;271(25):15018-15025.

• • Author

  • Thevissen K, Ghazi A, De Samblanx GW, Brownlee C, Osborn RW, Broekaert WF.