• DRAMP ID

    • DRAMP00798
    • Peptide Name

    • Cliotide T4 (cT4; Plant defensin)
    • Source

    • Clitoria ternatea (Butterfly pea)
    • Family

    • Belongs to the cyclotide family
    • Gene

    • Not found
    • Sequence

    • GIPCGESCVFIPCITGAIGCSCKSKVCYRN
    • Sequence Length

    • 30
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Anti-cancer
    • Target Organism

      • [Ref.21596752]Gram-positive bacteria: Staphylococcus aureus ATCC12600, Enterococcus faecalis ATCC 47077 (less active);
      • Gram-negative bacteria: Escherichia coli ATCC 700926 (MIC=1.3 µM), Pseudomonas aeruginosa ATCC 39018 (MIC=1.9 µM), Klebsiella pneumonia ATCC 13883 (MIC=1.5 µM).
    • Hemolytic Activity

      • [Ref.21596752] HD50 = 8.4 μM against human red blood cells
    • Cytotoxicity

      • [Ref.21596752] IC50=0.6 µM against HeLa cells.
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • There are three disulfide bonds between Cys4 and Cys20, Cys8 and Cys22, Cys13 and Cys27.
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00798 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C131H214N36O39S6
    • Absent Amino Acids

    • DHLMQW
    • Common Amino Acids

    • C
    • Mass

    • 3109.72
    • PI

    • 8.33
    • Basic Residues

    • 3
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 8
    • Net Charge

    • +2
    • Boman Index

    • -8.39
    • Hydrophobicity

    • 0.583
    • Aliphatic Index

    • 74.67
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1865
    • Absorbance 280nm

    • 64.31
    • Polar Residues

    • 16

DRAMP00798

DRAMP00798 chydropathy plot
    • Function

    • Cliotide T4 shows stronger antimicrobial activity against the Gram-negative bacteria than the Gram-positive bacteria. It also has hemolytic activity against human type A erythrocytes (HD50=8.4 µM) and cytotoxicity against HeLa Cells (IC50=0.6 µM).
    • [Note

    • HD50 refers to the peptide concentration that causes 50% lysis of red blood cells; IC50 refers to the peptide concentration that causes 50% death of HeLa cells].
  • ·Literature 1
    • Title

    • Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family.
    • Reference

    • J Biol Chem. 2011 Jul 8;286(27):24275-24287.
    • Author

    • Nguyen GK, Zhang S, Nguyen NT, Nguyen PQ, Chiu MS, Hardjojo A, Tam JP.