General Information
-
DRAMP ID
- DRAMP00810
-
Peptide Name
- Cycloviolacin-O7 (Plant defensin)
-
Source
- Viola odorata (Sweet violet)
-
Family
- Belongs to the cyclotide family
-
Gene
- Not found
-
Sequence
- SIPCGESCVWIPCTITALAGCKCKSKVCYN
-
Sequence Length
- 30
-
UniProt Entry
- P58439
-
Protein Existence
- Protein level
Activity Information
-
Biological Activity
- Insecticidal
-
Target Organism
- No MICs found in DRAMP database
-
Hemolytic Activity
-
- No hemolysis information or data found in the reference(s) presented in this entry
-
Cytotoxicity
- No cytotoxicity information found in the reference(s) presented
-
Binding Target
- Not found
Structure Information
-
Linear/Cyclic
- Cyclic
-
N-terminal Modification
- No specific N-terminal
-
C-terminal Modification
- No specific C-terminal
-
Nonterminal Modifications and Unusual Amino Acids
- Disulfide bonds between Cys4 and Cys21; Cys8 and Cys23; Cys13 and Cys28.
-
Stereochemistry
- L
-
Structure
- Bridge
-
Structure Description
- Not found
-
Helical Wheel Diagram
-
PDB ID
- None
-
Predicted Structure
- There is no predicted structure for DRAMP00810.
Physicochemical Information
-
Formula
- C136H221N35O40S6
Absent Amino Acids
- DFHMQR
Common Amino Acids
- C
Mass
- 3178.82
PI
- 8.28
Basic Residues
- 3
Acidic Residues
- 1
Hydrophobic Residues
- 9
Net Charge
- +2
-
Boman Index
- -2.31
Hydrophobicity
- 0.52
Aliphatic Index
- 78
Half Life
-
- Mammalian:1.9 hour
- Yeast:>20 hour
- E.coli:>10 hour
Extinction Coefficient Cystines
- 7365
Absorbance 280nm
- 253.97
Polar Residues
- 15
DRAMP00810
Comments Information
Function
- Probably participates in a plant defense mechanism.
PTM
- This is a cyclic peptide which contains three disulfide bonds 4-21; 8-23; 13-28.
Literature Information
- ·Literature 1
-
Title
- A novel suite of cyclotides from Viola odorata: sequence variation and the implications for structure, function and stability..
-
Pubmed ID
- 16872274
-
Reference
- Biochem J. 2006 Nov 15;400(1):1-12.
-
Author
- Ireland DC, Colgrave ML, Craik DJ.
- ·Literature 2
-
Title
- Plant cyclotides: A unique family of cyclic and knotted proteins that defines the cyclic cystine knot structural motif.
-
Pubmed ID
- 10600388
-
Reference
- J Mol Biol. 1999 Dec 17;294(5):1327-1336.
-
Author
- Craik DJ, Daly NL, Bond T, Waine C.
