General Information

    • DRAMP ID

    • DRAMP00811

    • Peptide Name

    • Cycloviolacin-O8 (Cyclotide c1; Plant defensin)

    • Source

    • Viola odorata (Sweet violet)

    • Family

    • Belongs to the cyclotide family

    • Gene

    • Voc1

    • Sequence

    • GTLPCESCVWIPCISSVVGCSCKSKVCYKN

    • Sequence Length

    • 30

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Insecticidal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • [Ref.29734037] Cytotoxicity against three cancer cell lines: MDA-MB-231 breast (IC50=1.15 μM), PC-3 prostate (IC50=1.05 μM), and OVCAR-3 ovarian (IC50=0.80 μM). Cytotoxicity against non-cancerous human dermal fibroblast cells was determined to be ∼3× less (3.13 μM) than cancer cell lines

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • No specific N-terminal

    • C-terminal Modification

    • No specific C-terminal

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys5 and Cys21; Cys9 and Cys23; Cys14 and Cys28.

    • Stereochemistry

    • L

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00811 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00811.

Physicochemical Information

    • Formula

    • C136H221N35O41S6

    • Absent Amino Acids

    • ADFHMQR

    • Common Amino Acids

    • C

    • Mass

    • 3194.82

    • PI

    • 8.33

    • Basic Residues

    • 3

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +2

    • Boman Index

    • -7

    • Hydrophobicity

    • 0.5

    • Aliphatic Index

    • 77.67

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 253.97

    • Polar Residues

    • 16

DRAMP00811

DRAMP00811 chydropathy plot

Comments Information

    • Function

    • Probably participates in a plant defense mechanism.

    • PTM

    • This is a cyclic peptide which contains three disulfide bonds 5-21; 9-23; 14-28.

Literature Information

  • ·Literature 1

    • Title

    • A novel suite of cyclotides from Viola odorata: sequence variation and the implications for structure, function and stability..

    • Reference

    • Biochem J. 2006 Nov 15;400(1):1-12.

    • Author

    • Ireland DC, Colgrave ML, Craik DJ.
  • ·Literature 2

    • Title

    • Plant cyclotides: A unique family of cyclic and knotted proteins that defines the cyclic cystine knot structural motif.

    • Reference

    • J Mol Biol. 1999 Dec 17;294(5):1327-1336.

    • Author

    • Craik DJ, Daly NL, Bond T, Waine C.