• DRAMP ID

    • DRAMP00816
    • Peptide Name

    • Cycloviolacin-O13 (Cyclotide c3; Plant defensin)
    • Source

    • Viola odorata (Sweet violet)
    • Family

    • Belongs to the cyclotide family
    • Gene

    • Voc3
    • Sequence

    • GIPCGESCVWIPCISAAIGCSCKSKVCYRN
    • Sequence Length

    • 30
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antiviral,Insecticidal
    • Target Organism

      • [Ref.18008336]Virus: HIV:inhibition the cytopathic effects of HIV-1 infection in cultured human T-lymphoblast (CEM-SS) cells(EC50=320 nM).
    • Hemolytic Activity

      • [Ref:16872274] It has 50% hemolytic activity at 1.0 μM and 75% hemolytic activity at 1.5 μM against human type A red blood cells
    • Cytotoxicity

      • [Ref.18008336]CEM-SS cells:IC50=6400 nM.
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Cyclization (N termini to C termini)
    • C-terminal Modification

    • Cyclization (N termini to C termini)
    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys4 and Cys20; Cys8 and Cys22; Cys13 and Cys27.
    • Stereochemistry

    • L
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00816 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00816.
    • Formula

    • C133H215N37O39S6
    • Absent Amino Acids

    • DFHLMQT
    • Common Amino Acids

    • C
    • Mass

    • 3148.75
    • PI

    • 8.33
    • Basic Residues

    • 3
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 9
    • Net Charge

    • +2
    • Boman Index

    • -9
    • Hydrophobicity

    • 0.53
    • Aliphatic Index

    • 78
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 7365
    • Absorbance 280nm

    • 253.97
    • Polar Residues

    • 15

DRAMP00816

DRAMP00816 chydropathy plot
    • Function

    • Probably participates in a plant defense mechanism. Has hemolytic activity.
    • PTM

    • This is a cyclic peptide which may contain three disulfide bonds 4-20; 8-22; 13-27.
  • ·Literature 1
    • Title

    • A novel suite of cyclotides from Viola odorata: sequence variation and the implications for structure, function and stability.
    • Reference

    • Biochem J. 2006 Nov 15;400(1):1-12.
    • Author

    • Ireland DC, Colgrave ML, Craik DJ.
  • ·Literature 2
    • Title

    • Cyclotides as natural anti-HIV agents.
    • Reference

    • Biopolymers. 2008;90(1):51-60.
    • Author

    • Ireland DC, Wang CK, Wilson JA, Gustafson KR, Craik DJ.