General Information

    • DRAMP ID

    • DRAMP00912

    • Peptide Name

    • Root cyclotide 1 (Vhr1; Plant defensin)

    • Source

    • Viola hederacea (Australian violet)

    • Family

    • Belongs to the cyclotide family

    • Gene

    • Not found

    • Sequence

    • GIPCAESCVWIPCTVTALLGCSCSNKVCYN

    • Sequence Length

    • 30

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Not found

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • No specific N-terminal

    • C-terminal Modification

    • No specific C-terminal

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys4 and Cys21, Cys8 and Cys23,Cys13 and Cys28.

    • Stereochemistry

    • L

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00912 helical wheel diagram

    • PDB ID

    • 1VB8 resolved by NMR.
  • 1VB8-> 

    • Predicted Structure

    • There is no predicted structure for DRAMP00912.

Physicochemical Information

    • Formula

    • C133H212N34O41S6

    • Absent Amino Acids

    • DFHMQR

    • Common Amino Acids

    • C

    • Mass

    • 3135.71

    • PI

    • 5.96

    • Basic Residues

    • 1

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 10

    • Net Charge

    • 0

    • Boman Index

    • 6.19

    • Hydrophobicity

    • 0.78

    • Aliphatic Index

    • 87.67

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 253.97

    • Polar Residues

    • 16

DRAMP00912

DRAMP00912 chydropathy plot

Comments Information

    • Function

    • Probably participates in a plant defense mechanism.

    • Tissue specificity

    • Expressed in roots.

    • PTM

    • Contains three disulfide bonds 4-21; 8-23; 13-28. This is a cyclic peptide (cross-link at G1-N30).

Literature Information

  • ·Literature 1

    • Title

    • Tissue-specific expression of head-to-tail cyclized miniproteins in Violaceae and structure determination of the root cyclotide Viola hederacea root cyclotide1.

    • Reference

    • Plant Cell. 2004 Aug;16(8):2204-2216.

    • Author

    • Trabi M, Craik DJ.