• DRAMP ID

    • DRAMP00919
    • Peptide Name

    • Cyclotide vibi-G (Plant defensin)
    • Source

    • Viola biflora (Yellow wood violet)
    • Family

    • Belongs to the cyclotide family
    • Gene

    • Not found
    • Sequence

    • GTFPCGESCVFIPCLTSAIGCSCKSKVCYKN
    • Sequence Length

    • 31
    • Protein Existence

    • Protein level
    • Biological Activity

    • Cytotoxic
    • Target Organism

    • Human lymphoma cell line U-937 GTB (IC50=0.96 µM).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • [Ref.18191970] Cytotoxicity: Human lymphoma cell line U-937 GTB (IC50=0.96 µM).
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • No specific N-terminal
    • C-terminal Modification

    • No specific C-terminal
    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys5 and Cys21; Cys9 and Cys23; Cys14 and Cys28.
    • Stereochemistry

    • L
    • Structure

    • Bridge
    • Structure Description

    • The cyclotides are head-to-tail macrocyclic and they have three disulfides arranged in a cystine knot, in which two disulfide bonds and their connecting backbone segments form an embedded ring that is penetrated by the third disulfide bond. Cyclotides exhibit a broad range of biological effects, including insecticidal, haemolytic, and cytotoxic effects.
    • Helical Wheel Diagram

    • DRAMP00919 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00919.
    • Formula

    • C139H221N35O42S6
    • Absent Amino Acids

    • DHMQRW
    • Common Amino Acids

    • C
    • Mass

    • 3246.85
    • PI

    • 8.33
    • Basic Residues

    • 3
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 8
    • Net Charge

    • +2
    • Boman Index

    • -7.87
    • Hydrophobicity

    • 0.471
    • Aliphatic Index

    • 59.68
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1865
    • Absorbance 280nm

    • 62.17
    • Polar Residues

    • 17

DRAMP00919

DRAMP00919 chydropathy plot
    • Function

    • Probably participates in a plant defense mechanism. Has cytotoxic activity.
    • PTM

    • Contains three disulfide bonds 5-21; 9-23; 14-28. This is a cyclic peptide (cross-link at G1-N31).
  • ·Literature 1
    • Title

    • The alpine violet, Viola biflora, is a rich source of cyclotides with potent cytotoxicity.
    • Reference

    • Phytochemistry. 2008 Feb;69(4):939-952.
    • Author

    • Herrmann A, Burman R, Mylne JS, Karlsson G, Gullbo J, Craik DJ, Clark RJ, Göransson U.