General Information

    • DRAMP ID

    • DRAMP00921

    • Peptide Name

    • Cyclotide vibi-I (Vbc2; Plant defensin)

    • Source

    • Viola biflora (Yellow wood violet)

    • Family

    • Belongs to the cyclotide family

    • Gene

    • Not found

    • Sequence

    • GIPCGESCVWIPCLTSTVGCSCKSKVCYRN

    • Sequence Length

    • 30

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Cytotoxic

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • The cyclotides are head-to-tail macrocyclic and they have three disulfides arranged in a cystine knot, in which two disulfide bonds and their connecting backbone segments form an embedded ring that is penetrated by the third disulfide bond. Cyclotides exhibit a broad range of biological effects, including insecticidal, haemolytic, and cytotoxic effects.

    • Helical Wheel Diagram

    • DRAMP00921 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00921.

Physicochemical Information

    • Formula

    • C134H217N37O41S6

    • Absent Amino Acids

    • ADFHMQ

    • Common Amino Acids

    • C

    • Mass

    • 3194.78

    • PI

    • 8.33

    • Basic Residues

    • 3

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +2

    • Boman Index

    • -18.64

    • Hydrophobicity

    • 0.33

    • Aliphatic Index

    • 68

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 253.97

    • Polar Residues

    • 17

DRAMP00921

DRAMP00921 chydropathy plot

Comments Information

    • Function

    • Probably participates in a plant defense mechanism.

    • PTM

    • Contains three disulfide bonds 4-20; 8-22; 13-27. This is a cyclic peptide (cross-link at G1-N30).

Literature Information

  • ·Literature 1

    • Title

    • The alpine violet, Viola biflora, is a rich source of cyclotides with potent cytotoxicity.

    • Reference

    • Phytochemistry. 2008 Feb;69(4):939-952.

    • Author

    • Herrmann A, Burman R, Mylne JS, Karlsson G, Gullbo J, Craik DJ, Clark RJ, Göransson U.