General Information

    • DRAMP ID

    • DRAMP00936

    • Peptide Name

    • Ribosome-inactivating protein TAP-29 (rRNA N-glycosidase; Plant defensin)

    • Source

    • Trichosanthes kirilowii (Chinese snake gourd) (Chinese cucumber)

    • Family

    • Belongs to the ribosome-inactivating protein family (Type 1 RIP subfamily)

    • Gene

    • Not found

    • Sequence

    • DVSFRLSGATSKKKVYFISNLRKALPNEKKLYDIPLVRSSXSGSK

    • Sequence Length

    • 45

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antiviral, Cytotoxic, Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00936 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00936.

Physicochemical Information

    • Formula

    • C222H366N62O63

    • Absent Amino Acids

    • CHMQW

    • Common Amino Acids

    • S

    • Mass

    • 5041.07

    • PI

    • 10.29

    • Basic Residues

    • 10

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +7

    • Boman Index

    • -93.17

    • Hydrophobicity

    • -0.493

    • Aliphatic Index

    • 84.44

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 2980

    • Absorbance 280nm

    • 67.73

    • Polar Residues

    • 15

DRAMP00936

DRAMP00936 chydropathy plot

Comments Information

    • Function

    • Capable of inhibiting HIV-1 infection and replication. It inactivates eukaryotic 60S ribosomal subunits.

    • Catalytic activity

    • Endohydrolysis of the N-glycosidic bond at one specific adenosine on the 28S rRNA.

Literature Information

  • ·Literature 1

    • Title

    • TAP 29: an anti-human immunodeficiency virus protein from Trichosanthes kirilowii that is nontoxic to intact cells.

    • Reference

    • Proc Natl Acad Sci U S A. 1991 Aug 1;88(15):6570-4.

    • Author

    • Lee-Huang S, Huang PL, Kung HF, Li BQ, Huang PL, Huang P, Huang HI, Chen HC.