General Information

    • DRAMP ID

    • DRAMP00953

    • Peptide Name

    • Viscotoxin-A2 (VtA2; Plant defensin)

    • Source

    • Viscum album (European mistletoe)

    • Family

    • Belongs to the thionin family

    • Gene

    • THI2.3

    • Sequence

    • KSCCPNTTGRNIYNTCRFGGGSREVCASLSGCKIISASTCPSYPDK

    • Sequence Length

    • 46

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Cytotoxic

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00953 helical wheel diagram

    • PDB ID

    • 1JMN resolved by NMR.
  • 1JMN-> 

    • Predicted Structure

    • There is no predicted structure for DRAMP00953.

Physicochemical Information

    • Formula

    • C199H323N61O67S6

    • Absent Amino Acids

    • HMQW

    • Common Amino Acids

    • S

    • Mass

    • 4834.48

    • PI

    • 8.9

    • Basic Residues

    • 6

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +4

    • Boman Index

    • -88.52

    • Hydrophobicity

    • -0.383

    • Aliphatic Index

    • 44.57

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 74.56

    • Polar Residues

    • 27

DRAMP00953

DRAMP00953 chydropathy plot

Comments Information

    • Function

    • Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane.

    • PTM

    • Contains three disulfide bonds 3-40; 4-32; 16-26.

Literature Information

  • ·Literature 1

    • Title

    • The disulphide bonds of viscotoxin A2 from the European mistletoe (Viscum album L. Loranthaceae).

    • Reference

    • Acta Pharm Suec. 1974 Sep;11(4):381-386.

    • Author

    • Olson T, Samuelsson G.
  • ·Literature 2

    • Title

    • Comparative membrane interaction study of viscotoxins A3, A2 and B from mistletoe (Viscum album) and connections with their structures.

    • Reference

    • Biochem J. 2003 Aug 15;374(Pt 1):71-78.

    • Author

    • Coulon A, Mosbah A, Lopez A, Sautereau AM, Schaller G, Urech K, Roug© P, Darbon H.