General Information

    • DRAMP ID

    • DRAMP00958

    • Peptide Name

    • Pp-AMP2 (P. pubescens AMP2; Plant defensin)

    • Source

    • Phyllostachys pubescens (Japanese bamboo shoots)

    • Family

    • Belongs to the thionin family

    • Gene

    • Not found

    • Sequence

    • KSCCRSTTARNIYNGCRVPGTARPVCAKKSGCKIQEAKKCEPPYD

    • Sequence Length

    • 45

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • Gram-negative bacteria: Erwinia carotovora (IC50=20 µg/ml), Agrobacterium radiobacter (IC50=13 µg/ml), Agrobacterium rhizogenes (IC50=15 µg/ml);
      • Gram-positive bacteria: Clavibacter michiganensis (IC50=18 µg/ml), Curtobacterium flaccumfaciens (IC50=20 µg/ml).
      • Fungi: Fusarium oxysporum (IC50=2 µg/ml), Geotrichum candidum (IC50=2 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Chitin-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00958 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00958.

Physicochemical Information

    • Formula

    • C204H342N66O63S6

    • Absent Amino Acids

    • FHLMW

    • Common Amino Acids

    • CK

    • Mass

    • 4919.72

    • PI

    • 9.42

    • Basic Residues

    • 10

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +7

    • Boman Index

    • -116.67

    • Hydrophobicity

    • -0.833

    • Aliphatic Index

    • 39.11

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 76.25

    • Polar Residues

    • 19

DRAMP00958

DRAMP00958 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Amino acid sequence and antimicrobial activity of chitin-binding peptides, Pp-AMP 1 and Pp-AMP 2, from Japanese bamboo shoots (Phyllostachys pubescens).

    • Reference

    • Biosci Biotechnol Biochem. 2005 Mar;69(3):642-645.

    • Author

    • Fujimura M, Ideguchi M, Minami Y, Watanabe K, Tadera K.