General Information

    • DRAMP ID

    • DRAMP00961

    • Peptide Name

    • Thionin (Plant defensin)

    • Source

    • Pyrularia pubera (Buffalo nut) (Oil nut)

    • Family

    • Belongs to the thionin family

    • Gene

    • THI1

    • Sequence

    • KSCCRNTWARNCYNVCRLPGTISREICAKKCDCKIISGTTCPSDYPK

    • Sequence Length

    • 47

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Cytotoxic

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00961 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00961.

Physicochemical Information

    • Formula

    • C220H362N68O67S8

    • Absent Amino Acids

    • FHMQ

    • Common Amino Acids

    • C

    • Mass

    • 5288.19

    • PI

    • 9.06

    • Basic Residues

    • 9

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +6

    • Boman Index

    • -109.05

    • Hydrophobicity

    • -0.511

    • Aliphatic Index

    • 51.91

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 8980

    • Absorbance 280nm

    • 195.22

    • Polar Residues

    • 23

DRAMP00961

DRAMP00961 chydropathy plot

Comments Information

    • Function

    • Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane.

    • Toxic dose

    • At concentrations of 0.04 mg/ml the protein causes visible disruption of cultured mouse B16 melanoma cells.

    • PTM

    • Contains three disulfide bonds 3-41; 4-31; 16-27 (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • A toxic thionin from Pyrularia pubera: purification, properties, and amino acid sequence.

    • Reference

    • Arch Biochem Biophys. 1985 Apr;238(1):18-29.

    • Author

    • Vernon LP, Evett GE, Zeikus RD, Gray WR.