• • DRAMP ID

  • DRAMP00969

• • Peptide Name

  • Alpha-hordothionin (alpha-HT; Plant defensin)

• • Source

  • Hordeum vulgare (Barley)

• • Family

  • Belongs to the thionin family

• • Gene

  • THI1.1

• • Sequence

  • KSCCRSTLGRNCYNLCRVRGAQKLCAGVCRCKLTSSGKCPTGFPK

• • Sequence Length

  • 45

• • UniProt Entry

  • P01545

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial, Antifungal

• • Target Organism

  • No MICs found in DRAMP database

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Not included yet

• • N-terminal Modification

  • Not included yet

• • C-terminal Modification

  • Not included yet

• • Nonterminal Modifications and Unusual Amino Acids

  • Not included yet

• • Stereochemistry

  • Not included yet

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP00969.

DRAMP00969

• • Function

  • Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane.

• ·Literature 1

• • Title

  • Cloning and nucleotide sequence of a cDNA encoding the precursor of the barley toxin alpha-hordothionin.

• • Pubmed ID

  • 3082629

• • Reference

  • Eur J Biochem. 1986 Apr 1;156(1):131-135.

• • Author

  • Ponz F, Paz-Ares J, Hern¡ndez-Lucas C, Garc­a-Olmedo F, Carbonero P.

• ·Literature 2

• • Title

  • Nucleotide sequence and endosperm-specific expression of the structural gene for the toxin alpha-hordothionin in barley (Hordeum vulgare L.).

• • Pubmed ID

  • 2850969

• • Reference

  • Gene. 1988 Oct 30;70(2):271-281.

• • Author

  • Rodr­guez-Palenzuela P, Pintor-Toro JA, Carbonero P, Garc­a-Olmedo F.