General Information

    • DRAMP ID

    • DRAMP00981

    • Peptide Name

    • Antimicrobial peptide 1b (WAMP-1b; Plant defensin)

    • Source

    • Triticum kiharae (wheat)

    • Family

    • Belongs to the hevein-like family

    • Gene

    • Not found

    • Sequence

    • AQRCGDQARGAKCPNCLCCGKYGFCGSGDAYCGAGSCQSQCRGCR

    • Sequence Length

    • 45

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • Fungi: Bipolaris sorokiniana (IC50=5 µg/ml), Botrytis cinerea (IC50=20 µg/ml), Fusarium oxysporum (IC50=5 µg/ml), F. solani (IC50=5 µg/ml), F. verticillioides (IC50=30 µg/ml), Neurospora crassa (IC50=10 µg/ml);
      • Gram-positive bacterium: Clavibacter michiganensis (1.3cm inhibition for 2.5 µg/50µl);
      • Gram-negative bacteria: Erwinia carotovora (1.1cm for 2.5 µg/50µl), Pseudomonas syringae (0.9cm for 2.5 µg/50µl).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Chitin-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00981 helical wheel diagram
  • 2LB7-> 

    • Predicted Structure

    • There is no predicted structure for DRAMP00981.

Physicochemical Information

    • Formula

    • C178H284N64O60S10

    • Absent Amino Acids

    • EHIMTVW

    • Common Amino Acids

    • C

    • Mass

    • 4601.21

    • PI

    • 8.62

    • Basic Residues

    • 6

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +4

    • Boman Index

    • -89.29

    • Hydrophobicity

    • -0.442

    • Aliphatic Index

    • 19.78

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3605

    • Absorbance 280nm

    • 81.93

    • Polar Residues

    • 25

DRAMP00981

DRAMP00981 chydropathy plot

Comments Information

    • PTM

    • Contains five disulfide bonds 4-19; 13-25; 16-44; 18-32; 37-41.

Literature Information

  • ·Literature 1

    • Title

    • A novel antifungal hevein-type peptide from Triticum kiharae seeds with a unique 10-cysteine motif.

    • Reference

    • FEBS J. 2009 Aug;276(15):4266-4275.

    • Author

    • Odintsova TI, Vassilevski AA, Slavokhotova AA, Musolyamov AK, Finkina EI, Khadeeva NV, Rogozhin EA, Korostyleva TV, Pukhalsky VA, Grishin EV, Egorov TA.
  • ·Literature 2

    • Title

    • Diversity of wheat anti-microbial peptides.

    • Reference

    • Peptides. 2005 Nov;26(11):2064-2073.

    • Author

    • Egorov TA, Odintsova TI, Pukhalsky VA, Grishin EV.