• DRAMP ID

    • DRAMP00983
    • Peptide Name

    • Fa-AMP2 (Fagopyrum antimicrobial peptide 2; hevein-type; Plant defensin)
    • Source

    • Fagopyrum esculentum Moench (buckwheat)
    • Family

    • Belongs to the hevein-like family
    • Gene

    • Not found
    • Sequence

    • AQCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNCR
    • Sequence Length

    • 40
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal
    • Target Organism

      • Gram-positive bacteria: Clavibacter michiganensis (IC50=17 µg/ml), Curtobacterium accumfaciens (IC50=15 µg/ml);
      • Gram-negative bacteria: Erwinia carotovora (IC50=15 µg/ml), Agrobacterium radiobacter (IC50=17 µg/ml), Agrobacterium rhizogenes (IC50=24 µg/ml).
      • Fungi: Fusarium oxysporum (IC50=29 µg/ml), Geotrichum candidum (IC50=25 µg/ml).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00983 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00983.
    • Formula

    • C156H237N51O52S8
    • Absent Amino Acids

    • DEFHIMV
    • Common Amino Acids

    • G
    • Mass

    • 3915.39
    • PI

    • 8.23
    • Basic Residues

    • 2
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 7
    • Net Charge

    • +2
    • Boman Index

    • -28.29
    • Hydrophobicity

    • -0.225
    • Aliphatic Index

    • 19.75
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 12990
    • Absorbance 280nm

    • 333.08
    • Polar Residues

    • 25

DRAMP00983

DRAMP00983 chydropathy plot
    • Function

    • Has antibacterial avtivity against Gram-positive bacteria and Gram-negative bacteria, also has antifungal activity.
  • ·Literature 1
    • Title

    • Purification, characterization, and sequencing of a novel type of antimicrobial peptides, Fa-AMP1 and Fa-AMP2, from seeds of buckwheat (Fagopyrum esculentum Moench.).
    • Reference

    • Biosci Biotechnol Biochem. 2003 Aug;67(8):1636-1642.
    • Author

    • Fujimura M, Minami Y, Watanabe K, Tadera K.