• DRAMP ID

    • DRAMP01007
    • Peptide Name

    • Non-specific lipid transfer peptide (LTP 1; nsLTP; Plants)
    • Source

    • Vigna radiata var. radiata (Mung bean) (Phaseolus aureus)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • MTCGQVQGNLAQCIGFLQKGGVVPPSCCTGVKNILNSSRTTADRRAVCSCLKAAAGAVRGINPNNAEALPGKCGVNIPYKISTSTNCNSIN
    • Sequence Length

    • 91
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Antifungal
    • Target Organism

      • Fungi: Fusarium solani, Fusarium oxysporum, Pythium aphanidermatum, Sclerotium rolfsii.
      • Gram-positive Bacterium: Staphylococcus aureus.
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Lipid-binding
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Alpha helix (4 helices; 46 residues)
    • Structure Description

    • The global fold of mung bean nsLTP1 is similar to those of the monocotyledonous nsLTP1 structures and consists of four alpha-helices stabilized by four disulfide bonds.
    • Helical Wheel Diagram

    • DRAMP01007 helical wheel diagram
    • PDB ID

    • 1SIY resolved by NMR.
  • 1SIY-> 
    • Predicted Structure

    • There is no predicted structure for DRAMP01007.
    • Formula

    • C388H652N122O124S9
    • Absent Amino Acids

    • HW
    • Common Amino Acids

    • GNA
    • Mass

    • 9298.73
    • PI

    • 9.25
    • Basic Residues

    • 9
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 28
    • Net Charge

    • +7
    • Boman Index

    • -107.22
    • Hydrophobicity

    • -0.003
    • Aliphatic Index

    • 79.34
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1990
    • Absorbance 280nm

    • 22.11
    • Polar Residues

    • 42

DRAMP01007

DRAMP01007 chydropathy plot
    • Function

    • Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.
    • PTM

    • Contains four disulfide bonds 3-50; 13-27; 28-73; 48-87.
  • ·Literature 1
    • Title

    • A non-specific lipid transfer protein with antifungal and antibacterial activities from the mung bean.
    • Reference

    • Peptides. 2004 Aug;25(8):1235-1242.
    • Author

    • Wang SY, Wu JH, Ng TB, Ye XY, Rao PF.
  • ·Literature 2
    • Title

    • Characterization and structural analyses of nonspecific lipid transfer protein 1 from mung bean.
    • Reference

    • Biochemistry. 2005 Apr 19;44(15):5703-5712.
    • Author

    • Lin KF, Liu YN, Hsu ST, Samuel D, Cheng CS, Bonvin AM, Lyu PC.