• DRAMP ID

    • DRAMP01014
    • Peptide Name

    • VrD1 (V.radiata defensin 1; Plants)
    • Source

    • Vigna radiata
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • RTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGNCKGMTRTCYCLVNC
    • Sequence Length

    • 46
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antifungal
    • Target Organism

      • Fungi: Fusarium oxysporum, Pyricularia oryza, Rhizoctonia solani, Trichophyton rubrum, bruchid larva.
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Combine helix and strand structure
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP01014 helical wheel diagram
    • PDB ID

    • 1TI5 resolved by NMR.
  • 1TI5-> 
    • Predicted Structure

    • There is no predicted structure for DRAMP01014.
    • Formula

    • C211H348N66O62S10
    • Absent Amino Acids

    • FPQ
    • Common Amino Acids

    • C
    • Mass

    • 5122.09
    • PI

    • 9.06
    • Basic Residues

    • 9
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 8
    • Net Charge

    • +7
    • Boman Index

    • -75.79
    • Hydrophobicity

    • -0.283
    • Aliphatic Index

    • 50.87
    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 8980
    • Absorbance 280nm

    • 199.56
    • Polar Residues

    • 25

DRAMP01014

DRAMP01014 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Cloning and functional expression of a mungbean defensin VrD1 in Pichia pastoris.
    • Reference

    • J Agric Food Chem 2004; 52: 2256-2261.
    • Author

    • Chen JJ et al Chen CS.