• DRAMP ID

    • DRAMP01017
    • Peptide Name

    • Antimicrobial peptide 2 (MJ-AMP2; Plant defensin)
    • Source

    • Mirabilis jalapa (Garden four-o'clock)
    • Family

    • Belongs to the AMP family
    • Gene

    • AMP2
    • Sequence

    • CIGNGGRCNENVGPPYCCSGFCLRQPNQGYGVCRNR
    • Sequence Length

    • 36
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Antifungal
    • Target Organism

      • Fungi: Alternaria brassicola (MIC=6 µg/ml), Ascochyta pisi (MIC=6 µg/ml), Botrytis cinerea (MIC=2 µg/ml), Cercospora beticola (MIC=2 µg/ml), Colletotrichum lindemuthianum (MIC=1 µg/ml), Fusarium culmorum (MIC=3 µg/ml), Fusarium oxysporum f.sp.pisi (MIC=5 µg/ml), Fusarium oxysporum f.sp.lycopersici (MIC=10 µg/ml), Nectria haematococca (MIC=0.5 µg/ml), Phoma betae (MIC=6 µg/ml), Pyrenophora tritici-repentis (MIC=20 µg/ml), Pyricularia oryzae (MIC=0.5 µg/ml), Rhizoctonia solani (MIC=15 µg/ml), Verticillium dahliae (MIC=0.5 µg/ml), Venturia inequalis (MIC=1 µg/ml).
      • Gram-positive bacteria:
        Target OrganismActivity
        Bacillus megateriumMIC=2 µg/ml
        Sarcina luteaMIC=50 µg/ml
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Cyclization of a N-terminal Cys residue (forming a disulfide bond)
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • There are three disulfide bonds between Cys1 and Cys18, Cys8 and Cys22, Cys17 and Cys33.
    • Stereochemistry

    • L
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP01017 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP01017.
    • Formula

    • C158H247N55O49S6
    • Absent Amino Acids

    • ADHKMTW
    • Common Amino Acids

    • G
    • Mass

    • 3893.4
    • PI

    • 8.69
    • Basic Residues

    • 4
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 5
    • Net Charge

    • +3
    • Boman Index

    • -79.29
    • Hydrophobicity

    • -0.625
    • Aliphatic Index

    • 37.78
    • Half Life

      • Mammalian:1.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 3355
    • Absorbance 280nm

    • 95.86
    • Polar Residues

    • 21

DRAMP01017

DRAMP01017 chydropathy plot
    • Function

    • Possesses antifungal activity and is also active on two tested Gram-positive bacteria
  • ·Literature 1
    • Title

    • Isolation and characterization of a novel class of plant antimicrobial peptides form Mirabilis jalapa L. seeds.
    • Reference

    • J Biol Chem. 1992 Feb 5;267(4):2228-2233.
    • Author

    • Cammue BP, De Bolle MF, Terras FR, Proost P, Van Damme J, Rees SB, Vanderleyden J, Broekaert WF.
  • ·Literature 2
    • Title

    • Cloning and characterization of two cDNA clones encoding seed-specific antimicrobial peptides from Mirabilis jalapa L.
    • Reference

    • Plant Mol Biol. 1995 Jul;28(4):713-721.
    • Author

    • De Bolle MF, Eggermont K, Duncan RE, Osborn RW, Terras FR, Broekaert WF.