General Information

    • DRAMP ID

    • DRAMP01018

    • Peptide Name

    • Cyclopsychotride-A (CPT; Plant defensin)

    • Source

    • Psychotria longipes

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • SIPCGESCVFIPCTVTALLGCSCKSKVCYKN

    • Sequence Length

    • 31

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • Gram-negative bacteria: Escherichia coli (MIC=1.55 µM), Pseudomonas aeruginosa (MIC=13.5 µM), Proteus vulgaris (MIC=13.2 µM), Klebsiella oxytoca (MIC=5.80 µM).
      • Gram-positive bacteria: Staphylococcus aureus (MIC=39.0 µM), Micrococcus luteus (MIC=48.0 µM).
      • Fungi: Candida albicans (MIC>500 µM), Candida kefyr (MIC=14.0 µM), Candida tropicalis (MIC=56.5 µM).
      • NOTE: Medium with 10 mM phosphate buffer.

    • Hemolytic Activity

      • [Ref.10430870] HD50 = 405 μM against blood type A human erythrocytes.

    • Cytotoxicity

      • [Ref.10430870] It caused 50% cell growth inhibition of mouse fibroblasts at 1850 μM.

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Cyclization (N termini to C termini)

    • C-terminal Modification

    • Cyclization (C termini to N termini)

    • Nonterminal Modifications and Unusual Amino Acids

    • There are three disulfide bonds between Cys4 and Cys21, Cys8 and Cys23, Cys13 and Cys28

    • Stereochemistry

    • L

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01018 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C139H229N35O42S6

    • Absent Amino Acids

    • DHMQRW

    • Common Amino Acids

    • C

    • Mass

    • 3254.92

    • PI

    • 8.28

    • Basic Residues

    • 3

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +2

    • Boman Index

    • -2.83

    • Hydrophobicity

    • 0.652

    • Aliphatic Index

    • 81.61

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 62.17

    • Polar Residues

    • 16

DRAMP01018

DRAMP01018 chydropathy plot

Comments Information

    • Function

    • Probably participates in a plant defense mechanism. Has antibiotic activity. Inhibits the cytopathic effects and replication of the human immunodeficiency virus. Active against both Gram-positive and Gram-negative bacteria.

    • PTM

    • This is a cyclic peptide which may contain three disulfide bonds 4-21; 8-23; 13-28.

Literature Information

  • ·Literature 1

    • Title

    • An unusual structural motif of antimicrobial peptides containing end-to-end macrocycle and cystine-knot disulfides.

    • Reference

    • Proc Natl Acad Sci U S A. 1999 Aug 3;96(16):8913-8918.

    • Author

    • Tam JP, Lu YA, Yang JL, Chiu KW.
  • ·Literature 2

    • Title

    • Cyclopsychotride A, a biologically active, 31-residue cyclic peptide isolated from Psychotria longipes.

    • Reference

    • J Nat Prod. 1994 Dec;57(12):1619-1625.

    • Author

    • Witherup KM, Bogusky MJ, Anderson PS, Ramjit H, Ransom RW, Wood T, Sardana M.