• DRAMP ID

    • DRAMP01019
    • Peptide Name

    • VrD2 (Vigna radiata defensin 2; plant defensin)
    • Source

    • Vigna radiata
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • KTCENLANTYRGPCFTTGSCDDHCKNKEHLRSGRCRDDFRCWCTRNC
    • Sequence Length

    • 47
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Combine helix and strand structure
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP01019 helical wheel diagram
    • PDB ID

    • 2GL1 resolved by NMR.
  • 2GL1-> 
    • Predicted Structure

    • There is no predicted structure for DRAMP01019.
    • Formula

    • C222H347N77O72S8
    • Absent Amino Acids

    • IMQV
    • Common Amino Acids

    • C
    • Mass

    • 5503.15
    • PI

    • 8.51
    • Basic Residues

    • 11
    • Acidic Residues

    • 6
    • Hydrophobic Residues

    • 6
    • Net Charge

    • +5
    • Boman Index

    • -177.34
    • Hydrophobicity

    • -1.175
    • Aliphatic Index

    • 18.72
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 7490
    • Absorbance 280nm

    • 162.83
    • Polar Residues

    • 23

DRAMP01019

DRAMP01019 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • NMR solution structure of Vigna radiata Defensin 2 (VrD2).
    • Reference

    • Proteins 2007; 68: 530-540.
    • Author

    • Lin KF, Lee TR, Tsai PH, Hsu MP, Chen CS, Lyu PC.