General Information

    • DRAMP ID

    • DRAMP01023

    • Peptide Name

    • Cy-AMP2 (Plant defensin)

    • Source

    • Cycas revoluta (cycad seeds)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • KGGPCAKKPCCGPLGHYKVDCSTIPDYPCCSKYGFCGSGPQYCG

    • Sequence Length

    • 44

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • Gram-positive bacteria: Clavibacterium michiganensis (IC50=7.6 µg/ml), Curtobacterium flaccumfaciens (IC50=8.3 µg/ml);
      • Gram-negative bacteria: Agrobacterium radiobacter (IC50=7.8 µg/ml), Agrobacterium rhizogenes (IC50=8.2 µg/ml), Erwinia carobora (IC50=8.1 µg/ml).
      • Fungi: Fusarium oxysporum (IC50=7.1 µg/ml), Geotrichum candidum (IC50=7.0 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Lipid-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01023 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01023.

Physicochemical Information

    • Formula

    • C197H296N52O58S8

    • Absent Amino Acids

    • EMNRW

    • Common Amino Acids

    • CG

    • Mass

    • 4577.31

    • PI

    • 8.47

    • Basic Residues

    • 6

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 5

    • Net Charge

    • +4

    • Boman Index

    • -32.29

    • Hydrophobicity

    • -0.391

    • Aliphatic Index

    • 26.59

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 6460

    • Absorbance 280nm

    • 150.23

    • Polar Residues

    • 24

DRAMP01023

DRAMP01023 chydropathy plot

Comments Information

    • Function

    • Cy-AMP2 has antimicrobial activity against various plant-pathogenic fungi and bacteria.

Literature Information

  • ·Literature 1

    • Title

    • Purification, characterization, and sequencing of antimicrobial peptides, Cy-AMP1, Cy-AMP2, and Cy-AMP3, from the Cycad (Cycas revoluta) seeds.

    • Reference

    • Peptides. 2008 Dec;29(12):2110-2117.

    • Author

    • Yokoyama S, Kato K, Koba A, Minami Y, Watanabe K, Yagi F.