• DRAMP ID

    • DRAMP01048
    • Peptide Name

    • Sd5 (sugarcane defensin 5; Plant defensin)
    • Source

    • Saccharum officinarum (Sugarcane)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • HTPTPTPICKSRSHEYKGRCIQDMDCNAACVKESESYTGGFCNGRPPFKQCFCTKPCKRERAAATLRWPGL
    • Sequence Length

    • 71
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antifungal
    • Target Organism

      • Fungi: Neurospora crassa and Fusarium solani (IC50=10-15 µM).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Combine helix and strand structure
    • Structure Description

    • Based on circular dichroism (CD) and nuclear magnetic resonance (NMR) spectroscopy showed that the structures of these Sds were compatible with alpha/beta proteins, a feature expected for plant defensins.
    • Helical Wheel Diagram

    • DRAMP01048 helical wheel diagram
    • PDB ID

    • 2KSK resolved by NMR.
  • 2KSK-> 
    • Predicted Structure

    • There is no predicted structure for DRAMP01048.
    • Formula

    • C340H534N104O100S9
    • Absent Amino Acids

    • ?
    • Common Amino Acids

    • CP
    • Mass

    • 7967.16
    • PI

    • 9.05
    • Basic Residues

    • 14
    • Acidic Residues

    • 6
    • Hydrophobic Residues

    • 14
    • Net Charge

    • +8
    • Boman Index

    • -169.15
    • Hydrophobicity

    • -0.786
    • Aliphatic Index

    • 33.1
    • Half Life

      • Mammalian:3.5 hour
      • Yeast:10 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 8980
    • Absorbance 280nm

    • 128.29
    • Polar Residues

    • 27

DRAMP01048

DRAMP01048 chydropathy plot
    • Function

    • Sd5 is active against fungi, but not against bacteria.
  • ·Literature 1
    • Title

    • Evolutionary relationship between defensins in the Poaceae family strengthened by the characterization of new sugarcane defensins.
    • Reference

    • Plant Mol Biol. 2008 Nov;68(4-5):321-335.
    • Author

    • De-Paula VS, Razzera G, Medeiros L, Miyamoto CA, Almeida MS, Kurtenbach E, Almeida FC, Valente AP.