• DRAMP ID

    • DRAMP01054
    • Peptide Name

    • Antimicrobial protein Ace-AMP1 (Ace-AMP1; Plant defensin)
    • Source

    • Allium cepa (onion)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • QNICPRVNRIVTPCVAYGLGRAPIAPCCRALNDLRFVNTRNLRRAACRCLVGVVNRNPGLRRNPRFQNIPRDCRNTFVRPFWWRPRIQCGRINLTDKLIYL
    • Sequence Length

    • 105
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Antifungal
    • Target Organism

      • Gram-positive bacteria:
        Target OrganismActivity
        Bacillus megaterium-
        Sarcina Lutea-
      • Fungi (SMF-, SMF+): Alternaria brassicola (IC50=2.5, 1.5 µg/ml), Ascockyta pisi (IC50=1, 10 µg/ml), Botrytis cinerea (IC50=3, 7 µg/ml), Colletotrickum lindemutkianum (IC50=1.5, 1.5 µg/ml), Fusarium culmorum (IC50=6, 10 µg/ml), Fusarium oxysporum fsp. pisi (IC50=3.5, 4 µg/ml), Fusarium oxysporum fsp. lycopersici (IC50=3, 10 µg/ml),Nectria haematococca (IC50=3.5, 7 µg/ml),Phoma betae (IC50=1.5, 7 µg/ml), Pyrenopkora tritici-repentis (IC50=3, 3.5 µg/ml), Pyricularia oryzae (IC50=3, 7 µg/ml), Verticillium dahliae (IC50=0.25, 0.5 µg/ml).
      • [NOTE: SMF- = Synthetic growth Medium with low ionic strength; SMF+ = Synthetic growth Medium supplemented with with 1 mM CaCl2, 50 mM KC1]
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP01054 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP01054.
    • Formula

    • C516H845N175O128S8
    • Absent Amino Acids

    • EHMS
    • Common Amino Acids

    • R
    • Mass

    • 11804.96
    • PI

    • 11.56
    • Basic Residues

    • 20
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 36
    • Net Charge

    • +17
    • Boman Index

    • -26199
    • Hydrophobicity

    • -0.309
    • Aliphatic Index

    • 90.69
    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 14480
    • Absorbance 280nm

    • 144.8
    • Polar Residues

    • 30

DRAMP01054

DRAMP01054 chydropathy plot
    • Function

    • Antifungal and antibacterial activity against the Gram-positive bacteria
    • PTM

    • Contains four disulfide bonds 4-49; 14-26; 28-73; 47-89.
  • ·Literature 1
    • Title

    • A potent antimicrobial protein from onion seeds showing sequence homology to plant lipid transfer proteins.
    • Reference

    • Plant Physiol. 1995 Oct;109(2):445-455.
    • Author

    • Cammue BP, Thevissen K, Hendriks M, Eggermont K, Goderis IJ, Proost P, Van Damme J, Osborn RW, Guerbette F, Kader JC, et al.
  • ·Literature 2
    • Title

    • Solution structure of Ace-AMP1, a potent antimicrobial protein extracted from onion seeds. Structural analogies with plant nonspecific lipid transfer proteins.
    • Reference

    • Biochemistry. 1998 Mar 17;37(11):3623-3637.
    • Author

    • Tassin S, Broekaert WF, Marion D, Acland DP, Ptak M, Vovelle F, Sodano P.