• DRAMP ID

    • DRAMP01162
    • Peptide Name

    • Buforin-1 (Buforin I; Fragment of Histone H2A; toads, amphibians, animals)
    • Source

    • Bufo gargarizans (Asian toad) (Bufo bufo gargarizans)
    • Family

    • Belongs to the histone H2A family
    • Gene

    • Not found
    • Sequence

    • AGRGKQGGKVRAKAKTRSSRAGLQFPVGRVHRLLRKGNY
    • Sequence Length

    • 39
    • Protein Existence

    • Protein level
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal
    • Target Organism

      • Gram-positive bacteria:
        Target OrganismActivity
        Bacillus subtilisMIC=4 µg/ml
        Staphylococcus aureusMIC=4 µg/ml
        Streptococcus mutansMIC=8 µg/ml
        Streptococcus pneumoniaeMIC=4 µg/ml
        Pseudomonas putidaMIC=4 µg/ml
      • Gram-negative bacteria:
        Target OrganismActivity
        Escherichia coliMIC=8 µg/ml
        Salmonella typhimuriumMIC=4 µg/ml
        Serratia sp.MIC=8 µg/ml
      • Fungi:
        Target OrganismActivity
        Candida albicansMIC=4 µg/ml
        Cryptococcus neoformansMIC=4 µg/ml
        Saccharomyces cerevisiaeMIC=4 µg/ml
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • DNA
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • ①The residue at position 5 is N6-(2-hydroxyisobutyryl)lysine or N6-acetyllysine. ②The residue at position 9 is N6-(2-hydroxyisobutyryl)lysine or N6-lactoyllysine or N6-succinyllysine. ③The Lys13 has a interchain with G-Cter in ubiquitin. ④The Lys15 has a interchain with G-Cter in ubiquitin. ⑤The residue at position 36 is N6-(2-hydroxyisobutyryl)lysine.
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C184H318N70O47
    • Absent Amino Acids

    • CDEIMW
    • Common Amino Acids

    • GR
    • Mass

    • 4262.99
    • PI

    • 12.41
    • Basic Residues

    • 13
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 11
    • Net Charge

    • +13
    • Boman Index

    • -120.4
    • Hydrophobicity

    • -0.992
    • Aliphatic Index

    • 62.56
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1490
    • Absorbance 280nm

    • 39.21
    • Polar Residues

    • 12

DRAMP01162

    • Function

    • Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
    • PTM

    • Monoubiquitination of C-terminus gives a specific tag for epigenetic transcriptional repression. Following DNA double-strand breaks (DSBs), it is ubiquitinated through 'Lys-63' linkage of ubiquitin moieties.
  • ·Literature 1
    • Title

    • A novel antimicrobial peptide from Bufo bufo gargarizans.
    • Reference

    • Biochem Biophys Res Commun. 1996 Jan 5;218(1):408-413.
    • Author

    • Park C.B, Kim M.S, Kim S.C.
  • ·Literature 2
    • Title

    • Solution structure of an antimicrobial peptide buforin II.
    • Reference

    • FEBS Lett. 1996 Nov 25;398(1):87-90.
    • Author

    • Yi G.-S, Park C.B, Kim S.C, Cheong C.