General Information

    • DRAMP ID

    • DRAMP01210

    • Peptide Name

    • Pleurain-D1 antimicrobial peptide (Frogs, amphibians, animals)

    • Source

    • Rana pleuraden (Yunnan pond frog)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MFTLKKTLLLLFFLGTINLSLCKEERDADEERRDDPDKRDVEVEKRFLSGILKLAFKIPSVLCAVLKNC

    • Sequence Length

    • 69

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01210 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01210.

Physicochemical Information

    • Formula

    • C359H594N94O102S4

    • Absent Amino Acids

    • HQWY

    • Common Amino Acids

    • L

    • Mass

    • 7987.47

    • PI

    • 7.68

    • Basic Residues

    • 13

    • Acidic Residues

    • 12

    • Hydrophobic Residues

    • 28

    • Net Charge

    • +1

    • Boman Index

    • -120.09

    • Hydrophobicity

    • -0.039

    • Aliphatic Index

    • 111.59

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 125

    • Absorbance 280nm

    • 1.84

    • Polar Residues

    • 13

DRAMP01210

DRAMP01210 chydropathy plot

Comments Information

    • Function

    • Amphibian defense peptide.

Literature Information

  • ·Literature 1

    • Title

    • Antioxidant peptidomics reveals novel skin antioxidant system.

    • Reference

    • Mol Cell Proteomics. 2009 Mar;8(3):571-583.

    • Author

    • Yang H, Wang X, Liu X, Wu J, Liu C, Gong W, Zhao Z, Hong J, Lin D, Wang Y, Lai R.