• DRAMP ID

    • DRAMP01211
    • Peptide Name

    • Pleurain-D2 antimicrobial peptide (Frogs, amphibians, animals)
    • Source

    • Rana pleuraden (Yunnan pond frog)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • MFTLKKTLLLLFFLGTINLSLCKEERDADEERRDDPDKRDVEVEKRFLSGILKLASKIPSVLCAVLKNC
    • Sequence Length

    • 69
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP01211 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP01211.
    • Formula

    • C353H590N94O103S4
    • Absent Amino Acids

    • HQWY
    • Common Amino Acids

    • L
    • Mass

    • 7927.38
    • PI

    • 7.68
    • Basic Residues

    • 13
    • Acidic Residues

    • 12
    • Hydrophobic Residues

    • 27
    • Net Charge

    • +1
    • Boman Index

    • -126.47
    • Hydrophobicity

    • -0.091
    • Aliphatic Index

    • 111.59
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 125
    • Absorbance 280nm

    • 1.84
    • Polar Residues

    • 14

DRAMP01211

DRAMP01211 chydropathy plot
    • Function

    • Amphibian defense peptide.
  • ·Literature 1
    • Title

    • Antioxidant peptidomics reveals novel skin antioxidant system.
    • Reference

    • Mol Cell Proteomics. 2009 Mar;8(3):571-583.
    • Author

    • Yang H, Wang X, Liu X, Wu J, Liu C, Gong W, Zhao Z, Hong J, Lin D, Wang Y, Lai R.