General Information

    • DRAMP ID

    • DRAMP01234

    • Peptide Name

    • Palustrin-3a (Frogs, amphibians, animals)

    • Source

    • Rana palustris (Pickerel frog)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GIFPKIIGKGIKTGIVNGIKSLVKGVGMKVFKAGLNNIGNTGCNEDEC

    • Sequence Length

    • 48

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-

    • Target Organism

      • Gram-negative bacterium: Escherichia coli (MIC=1 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Cyclization (Cys43 and Cys48)

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys43 and Cys48.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01234 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C218H368N60O63S3

    • Absent Amino Acids

    • HQRWY

    • Common Amino Acids

    • G

    • Mass

    • 4933.86

    • PI

    • 9.45

    • Basic Residues

    • 7

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 16

    • Net Charge

    • +4

    • Boman Index

    • -20.41

    • Hydrophobicity

    • 0.148

    • Aliphatic Index

    • 99.38

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 125

    • Absorbance 280nm

    • 2.66

    • Polar Residues

    • 20

DRAMP01234

DRAMP01234 chydropathy plot

Comments Information

    • Tissue specificity

    • Expressed by the skin glands.

Literature Information

  • ·Literature 1

    • Title

    • Multiple antimicrobial peptides and peptides related to bradykinin and neuromedin N isolated from skin secretions of the pickerel frog, Rana palustris.

    • Reference

    • Biochim Biophys Acta. 2000 Nov 30;1543(1):95-105.

    • Author

    • Basir YJ, Knoop FC, Dulka J, Conlon JM.