General Information

    • DRAMP ID

    • DRAMP01238

    • Peptide Name

    • Palustrin-2SIb (Frogs, amphibians, animals)

    • Source

    • Odorrana ishikawae

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GLWNSIKIAGKKLFVNVLDKIRCKVAGGCKTSPDVE

    • Sequence Length

    • 36

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-negative bacterium: Escherichia coli (MIC=6.3 µM);
      • Gram-positive bacteria: Staphylococcus aureus (MIC=6.3 µM), S. aureus (MRSA) (MIC=100 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys23 and Cys29.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01238 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C174H292N48O48S2

    • Absent Amino Acids

    • HMQY

    • Common Amino Acids

    • K

    • Mass

    • 3888.65

    • PI

    • 9.51

    • Basic Residues

    • 7

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +4

    • Boman Index

    • -34.19

    • Hydrophobicity

    • 0.036

    • Aliphatic Index

    • 102.78

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5625

    • Absorbance 280nm

    • 160.71

    • Polar Residues

    • 11

DRAMP01238

DRAMP01238 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Identification and structure-activity relationship of an antimicrobial peptide of the palustrin-2 family isolated from the skin of the endangered frog Odorrana ishikawae.

    • Reference

    • Peptides. 2011 Oct;32(10):2052-2057.

    • Author

    • Iwakoshi-Ukena E, Okada G, Okimoto A, Fujii T, Sumida M, Ukena K.2011.