• DRAMP ID

    • DRAMP01259
    • Peptide Name

    • Dermadistinctin-M (DD M; Frogs, amphibians, animals)
    • Source

    • Phyllomedusa distincta (Monkey frog)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • ALWKTMLKKLGTMALHAGKAAFGAAADTISQ
    • Sequence Length

    • 31
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • Gram-positive bacteria:
        Target OrganismActivity
        Staphylococcus aureusMIC=38 µM
        Enterococcus faecalis (MIC>38 µM);-
      • Gram-negative bacteria:
        Target OrganismActivity
        Pseudomonas aeruginosaMIC=38 µM
        Escherichia coliMIC=9.7 µM
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • Free
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP01259 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP01259.
    • Formula

    • C144H237N39O39S2
    • Absent Amino Acids

    • CENPRVY
    • Common Amino Acids

    • A
    • Mass

    • 3202.82
    • PI

    • 10
    • Basic Residues

    • 5
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 15
    • Net Charge

    • +4
    • Boman Index

    • -0.32
    • Hydrophobicity

    • 0.319
    • Aliphatic Index

    • 88.71
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 5500
    • Absorbance 280nm

    • 183.33
    • Polar Residues

    • 7

DRAMP01259

DRAMP01259 chydropathy plot
    • Function

    • Amphibian defense peptide.
    • Tissue specificity

    • Expressed by the skin glands.
  • ·Literature 1
    • Title

    • Antimicrobial peptides from the Brazilian frog Phyllomedusa distincta.
    • Reference

    • Peptides. 1999;20(6):679-686.
    • Author

    • Batista CV, da Silva LR, Sebben A, Scaloni A, Ferrara L, Paiva GR, Olamendi-Portugal T, Possani LD, Bloch C Jr.