General Information

    • DRAMP ID

    • DRAMP01259

    • Peptide Name

    • Dermadistinctin-M (DD M; Frogs, amphibians, animals)

    • Source

    • Phyllomedusa distincta (Monkey frog)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • ALWKTMLKKLGTMALHAGKAAFGAAADTISQ

    • Sequence Length

    • 31

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-positive bacteria: Staphylococcus aureus (MIC=38 µM), Enterococcus faecalis (MIC>38 µM);
      • Gram-negative bacteria: Pseudomonas aeruginosa (MIC=38 µM), Escherichia coli (MIC=9.7 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Free

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01259 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C144H237N39O39S2

    • Absent Amino Acids

    • CENPRVY

    • Common Amino Acids

    • A

    • Mass

    • 3202.82

    • PI

    • 10

    • Basic Residues

    • 5

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +4

    • Boman Index

    • -0.32

    • Hydrophobicity

    • 0.319

    • Aliphatic Index

    • 88.71

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 183.33

    • Polar Residues

    • 7

DRAMP01259

DRAMP01259 chydropathy plot

Comments Information

    • Function

    • Amphibian defense peptide.

    • Tissue specificity

    • Expressed by the skin glands.

Literature Information

  • ·Literature 1

    • Title

    • Antimicrobial peptides from the Brazilian frog Phyllomedusa distincta.

    • Reference

    • Peptides. 1999;20(6):679-686.

    • Author

    • Batista CV, da Silva LR, Sebben A, Scaloni A, Ferrara L, Paiva GR, Olamendi-Portugal T, Possani LD, Bloch C Jr.